PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G238300.1
Common NameB456_002G238300, LOC105786326
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 234aa    MW: 27292.8 Da    PI: 8.4171
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G238300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM144.65.3e-4541391127
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.....leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgy 82 
                         +ppGfrF Pt+eelv++yL+kk+e+k+     + +++vi+ vdiy+++PwdLp+     ++++ ++w+fF++r++++a+g r++r t+sgy
  Gorai.002G238300.1   4 MPPGFRFYPTEEELVSFYLHKKLEAKTdddlnHVMNRVIPVVDIYNFNPWDLPRfsdnLCHKDPEQWFFFIPRQESEARGGRPKRLTSSGY 94 
                         79************************988876555668**************9546654445677************************** PP

                 NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                         Wkatg+   v+s +++ +g+k+t+vfy+grap+g+ktdW m+ey+
  Gorai.002G238300.1  95 WKATGSPGYVYSFNSRPIGVKRTMVFYNGRAPNGKKTDWKMNEYK 139
                         ********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-483168IPR003441NAC domain
PROSITE profilePS5100549.074168IPR003441NAC domain
PfamPF023656.2E-235139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MEDMPPGFRF YPTEEELVSF YLHKKLEAKT DDDLNHVMNR VIPVVDIYNF NPWDLPRFSD  60
NLCHKDPEQW FFFIPRQESE ARGGRPKRLT SSGYWKATGS PGYVYSFNSR PIGVKRTMVF  120
YNGRAPNGKK TDWKMNEYKA IQDHVSLANA TTPPTLRQEF SLCRVYKKSK CLRSFDRRPP  180
GILKIGELFP GLDNNQYINR FTQIGMNDNS STKKDVVDDD EYAFWDVDGF WNL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-34316816165NO APICAL MERISTEM PROTEIN
1ut4_B6e-34316816165NO APICAL MERISTEM PROTEIN
1ut7_A6e-34316816165NO APICAL MERISTEM PROTEIN
1ut7_B6e-34316816165NO APICAL MERISTEM PROTEIN
3swm_A6e-34316819168NAC domain-containing protein 19
3swm_B6e-34316819168NAC domain-containing protein 19
3swm_C6e-34316819168NAC domain-containing protein 19
3swm_D6e-34316819168NAC domain-containing protein 19
3swp_A6e-34316819168NAC domain-containing protein 19
3swp_B6e-34316819168NAC domain-containing protein 19
3swp_C6e-34316819168NAC domain-containing protein 19
3swp_D6e-34316819168NAC domain-containing protein 19
4dul_A6e-34316816165NAC domain-containing protein 19
4dul_B6e-34316816165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472470.0KC847247.1 Gossypium hirsutum NAC domain protein NAC70 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001314212.11e-176NAC domain-containing protein 90-like
RefseqXP_012468159.11e-176PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR34e-74NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A0D2NS401e-174A0A0D2NS40_GOSRA; Uncharacterized protein
TrEMBLW6J9011e-174W6J901_GOSHI; NAC domain protein NAC70
STRINGGorai.002G238300.11e-175(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM101591034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.12e-76NAC domain containing protein 90
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]