PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G234400.1
Common NameB456_002G234400, LOC105786289
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 331aa    MW: 36276.1 Da    PI: 8.7091
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G234400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA97.81.2e-30162218158
           CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         d p+YVNaKQy++Il+RRq+Rak+  e+kl +k+rkpy+h SRh hA+rRpRg+gGrF
  Gorai.002G234400.1 162 DGPIYVNAKQYNGILRRRQSRAKAVLENKL-TKARKPYMHYSRHLHAMRRPRGCGGRF 218
                         57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.8E-34160221IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.446161221IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.4E-21164186IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.5E-26164218IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.4E-21195218IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MAMQTLHVKE HDGIVHNPMG QLAPVPSQPW WSALGSQSSI YGESCGQLKN LLMEHPSNGD  60
HLTCTKQAGR VTEQGLNKGN PAHFTIFPGD GKCSGDGQKS PTVISLQSVP SEQHSRFELG  120
CGQPPMVCAK YPYMDQCYGV FSTYGPPVSG RVMLPLNIAS EDGPIYVNAK QYNGILRRRQ  180
SRAKAVLENK LTKARKPYMH YSRHLHAMRR PRGCGGRFLN TKTGKDEKET KKYVEGKDLH  240
ITGSQNSEVL QSDSGTLNSS KEAIGGGLTL SGSEVTSMYS REELEHNFPI NHLGLSFHSF  300
PVMMENGSGS VMPNRWVAPA DHCLQPIPRD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-16162222262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012468119.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like
TrEMBLA0A0D2QB350.0A0A0D2QB35_GOSRA; Uncharacterized protein
STRINGGorai.002G234400.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30082767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.21e-53nuclear factor Y, subunit A10
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]