PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G218400.1
Common NameB456_002G218400, LOC105786119
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CO-like
Protein Properties Length: 422aa    MW: 46533.5 Da    PI: 7.6159
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G218400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box30.47.8e-101759440
            zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                        r C+ + +k+++++C  ++ +lC+ C ++ H+       H++v
  Gorai.002G218400.1 17 RACDSCIKKRARWYCAADDAFLCQACDSSVHSAnplarrHKRV 59
                        78*****************************668888889887 PP

2CCT68.12.4e-23365408144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  Gorai.002G218400.1 365 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 408
                         9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.8081461IPR000315B-box-type zinc finger
SMARTSM003364.4E-111461IPR000315B-box-type zinc finger
CDDcd000212.67E-111761No hitNo description
PfamPF006431.1E-71759IPR000315B-box-type zinc finger
PfamPF062037.0E-18365407IPR010402CCT domain
PROSITE profilePS5101716.083365407IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MISSKKMANA VGAKTVRACD SCIKKRARWY CAADDAFLCQ ACDSSVHSAN PLARRHKRVR  60
LKTASVKSSG DELPLESFSP SWDRGFTRKA RTRRPVKGSI HRKPLKAKNN PVPVVPEVGI  120
DEIFNEENEE EQLLYRVPIF DPFVAELCTS TTSTEAAVSA VGNEAETAAT ESKAFMGQDV  180
DGSHGLFPSE MDLAEFAADV ESLLGKGLEN ESFTMVELGL TGSKDLREYS YGNGQVKIED  240
EESFEGGMAR EPFELSFNYD SPPSCGGVDE LVKEEVEVKS KEGGECQENT AKKKKRKTLL  300
SLDYEAVITA WATQGSPWTS GGKPDLDPDE CWPDCMGNGG TEVQQSYSGL MGMGGQQQAM  360
GDGGREARVS RYREKRRTRL FSKKIRYEVR KLNAEKRPRM KGRFVKRASF LTGPAFPLLN  420
K*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1291296KKKKRK
2375391RRTRLFSKKIRYEVRKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.7051e-180flower|seedling| flowering
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6183350.0JQ618335.1 Gossypium hirsutum constans-like protein 5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467882.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16 isoform X1
SwissprotQ8RWD01e-107COL16_ARATH; Zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A0D2NRA70.0A0A0D2NRA7_G
STRINGVIT_01s0011g03520.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24672767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.14e-95B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]