PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G207000.1
Common NameB456_002G207000, LOC105786001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 288aa    MW: 31304.3 Da    PI: 9.5597
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G207000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.51.6e-14206260458
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                          +++rr++kNRe+A rsR+RK+a++ eLe  v +Le+e  +L  e  el+k   k
  Gorai.002G207000.1 206 QQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEEKARLLREEAELNKARFK 260
                         689**************************************99888888887654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.1E-13201263No hitNo description
SMARTSM003383.3E-12203267IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.944205256IPR004827Basic-leucine zipper domain
PfamPF001701.2E-11205264IPR004827Basic-leucine zipper domain
CDDcd147071.33E-21207257No hitNo description
SuperFamilySSF579596.0E-10208255No hitNo description
PROSITE patternPS000360210225IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MASSKVITTT SQTNPDLPRQ PSLCPSLSTL LADLQNQQNN QNQSQNGLGS MNMDDLLKNI  60
CSSPPPPPPT SDSHPQFAGV SISCEGSFSL PKDVANKSVD EVWKDIVVGG DDKRQGNPPV  120
GMTLEDFLTK AGAVREEDVR GVVNQVGVGA GVYPVDPAVI NGGGNHFSAF GNSGGVDHQR  180
LVAVAGGGAR GKRRAVEAPP LDKATQQKQR RMIKNRESAA RSRERKQAYT VELESLVTQL  240
EEEKARLLRE EAELNKARFK QLMENLVPVV EKRRPPRVLR RVHSMQW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.14390.0flower| flowering
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO488009900.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467680.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLA0A0D2R9Z90.0A0A0D2R9Z9_G
STRINGVIT_12s0055g00420.t017e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16538611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.18e-20bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]