PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G197800.2
Common NameB456_002G197800, LOC105785918
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 258aa    MW: 27918.2 Da    PI: 6.4984
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G197800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_125.23.5e-0889135551
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                         k  +r   NReA r++R++ ka+ + Le++v  L a N++L k+l+ 
  Gorai.002G197800.2  89 KSKKRPLGNREAVRKYREKVKARAASLEDEVVRLRALNQQLVKRLQG 135
                         77899999**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-785152IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.1E-1286153No hitNo description
PfamPF077161.4E-1387142IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.05E-589135No hitNo description
CDDcd146863.34E-1191144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MDDGELDYSN QEVFSVNNMG DIPSSCSMDS FFDELLNDSH ACTHTHTCNP PGPDNSHTHT  60
CFHFHTKIVP ASSEDKAAID GTAVSGENKS KKRPLGNREA VRKYREKVKA RAASLEDEVV  120
RLRALNQQLV KRLQGQAALE AEVARLKCLL VDIRGRIEGE IGPFPYQKPA TNVNMMNVPG  180
AYVMNPCNVQ CNDQMYCLHP GLEDKTGEAA ALNGQGFNGC DFDNIQCLAN QNSTGGIGIA  240
GLNGNYSGTK RRKATAG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467575.10.0PREDICTED: uncharacterized protein LOC105785918 isoform X2
SwissprotQ8GTS21e-112BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A0D2Q9760.0A0A0D2Q976_G
STRINGVIT_03s0038g02420.t011e-137(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.11e-113bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]