PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G190600.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 367aa    MW: 41934.3 Da    PI: 6.7542
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G190600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix80.13.1e-2555136286
            trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         W ++e++ Li +r+em+ r++++k++k+lWe++s+ mr++gf rsp++C++kw+nl k++kk k+ +++  s+s+ ++ y++++e
  Gorai.002G190600.2  55 WVQDETRSLIGFRKEMDGRFNTSKSNKHLWEKISAMMRKKGFDRSPTMCTDKWRNLLKEFKKAKHPDRG--SGSV-KMCYYKEIE 136
                         *****************************************************************9998..5666.566999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-445116IPR009057Homeodomain-like
PROSITE profilePS500908.26947111IPR017877Myb-like domain
SMARTSM007172.6E-451113IPR001005SANT/Myb domain
CDDcd122039.48E-2853118No hitNo description
PfamPF138371.3E-1954138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MARDMIIEVT TNGGFPDHLH HHHPHSLQQQ QQMILGESSG DDPEVKAPKK RAETWVQDET  60
RSLIGFRKEM DGRFNTSKSN KHLWEKISAM MRKKGFDRSP TMCTDKWRNL LKEFKKAKHP  120
DRGSGSVKMC YYKEIEEILR ERTQKSYKAP TPPPKLDSFM HFSDKGLCFE DTSITFGPLE  180
ASGRPALNIE QGLDYDGHPL AITTANAVAA SGVPPWNWRE TPGNGGDCLP YGGRVITVKY  240
GDYTQRIGID GTTEAIREAI KSAFRLRTKR AFWLEDEDHI VRSLDREMPL GNYKLHLDEG  300
LAVKVCLYDE SDHIPVHTEE KIFYTEDDYR EYLVLRGYAG LREIDGYRNI DSMDDLQTNT  360
IYRGVS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A2e-4649134186DNA binding protein GT-1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specifically to the core DNA sequence 5'-GGTTAA-3'. May act as a molecular switch in response to light signals. {ECO:0000269|PubMed:10437822, ECO:0000269|PubMed:15044016, ECO:0000269|PubMed:7866025}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467488.10.0PREDICTED: trihelix transcription factor GT-1-like isoform X2
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A1U8KXS80.0A0A1U8KXS8_GOSHI; trihelix transcription factor GT-1-like isoform X2
STRINGGorai.002G190600.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.10.0Trihelix family protein
Publications ? help Back to Top
  1. Le Gourrierec J,Li YF,Zhou DX
    Transcriptional activation by Arabidopsis GT-1 may be through interaction with TFIIA-TBP-TATA complex.
    Plant J., 1999. 18(6): p. 663-8
    [PMID:10417717]