PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G151800.2
Common NameB456_002G151800, LOC105785404
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 354aa    MW: 38949.7 Da    PI: 8.8514
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G151800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.31.1e-32174230158
           CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         +ep+YVNaKQy++Il+RRq+Rak+e ekkl +k rkpylheSRh hA+rR+Rg+gGrF
  Gorai.002G151800.2 174 EEPVYVNAKQYHGILRRRQSRAKAELEKKL-IKVRKPYLHESRHLHAMRRARGCGGRF 230
                         69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.0E-37172233IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.337173233IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.2E-27175230IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.8E-24176198IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860178198IPR018362CCAAT-binding factor, conserved site
PRINTSPR006165.8E-24207230IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MHQKPDGTNH PEPNANNNKP QMVQVQPCWC STRQDSFLTG VLGEGRTSLS LAKHSNGGLG  60
TKTSESPSTI RTDDKLCSSK EMPLTIFPHP DGKCGDEQPY LQHAIPIIRP TMGEYVPPEP  120
QLELVGHSIA CPSYPYTDPY YGGVVPPYVP QSLVHSHSLG VHPARMALPL EMAEEPVYVN  180
AKQYHGILRR RQSRAKAELE KKLIKVRKPY LHESRHLHAM RRARGCGGRF LNTKKLDSDA  240
SKATPNKSSD TSLNLPSQCP ENTSGISVTN QMSQNDNSSV GHRAAAESEL QGTNMQQAFS  300
NGNGSGYYSH HQGFRFSTSR SLSNDMLEGG DCPRQQYERI MANGVPHRAL TIK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-21174238266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in inflorescence, stems, flowers and siliques. {ECO:0000269|PubMed:11867211}.
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5857312e-32JX585731.1 Gossypium hirsutum clone NBRI_GE19383 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012466939.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like
RefseqXP_012466940.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like
RefseqXP_012466941.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like
RefseqXP_012466942.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like
SwissprotQ945M95e-43NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
TrEMBLA0A0D2Q7050.0A0A0D2Q705_GOSRA; Uncharacterized protein
STRINGGorai.002G151800.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.12e-37nuclear factor Y, subunit A9
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]