PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G122200.1
Common NameB456_002G122200, LOC105784201
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 181aa    MW: 19870.7 Da    PI: 10.3771
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G122200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.72.9e-14110159352
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                         ++ r +rk+kNR +A rsR+RK+a++ eLe +v+ L +eN +L+ + ++l
  Gorai.002G122200.1 110 DDPRHKRKIKNRKSAARSRARKQAYTNELELEVARLLEENVKLRRQQDKL 159
                         6889****************************************877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.1E-10108172IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.898110159IPR004827Basic-leucine zipper domain
CDDcd147079.79E-24113165No hitNo description
Gene3DG3DSA:1.20.5.1702.4E-12113160No hitNo description
SuperFamilySSF579594.85E-10113160No hitNo description
PfamPF001708.9E-12113159IPR004827Basic-leucine zipper domain
PROSITE patternPS000360115130IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MEEVWGDIGL ASLNDHPAVT PTANPPSFPS VILQDFLAIP INKEMPPTAR SGCGTSLTEE  60
TTLFGSLPPT PATLFTLNAR SIASVAVKAP APSFPSSCRK KGQENEENSD DPRHKRKIKN  120
RKSAARSRAR KQAYTNELEL EVARLLEENV KLRRQQDKLL ASPRQIPKRN TLCRTLTAPF  180
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465462.11e-129PREDICTED: protein FD-like
RefseqXP_012465469.11e-129PREDICTED: protein FD-like
RefseqXP_012465476.11e-129PREDICTED: protein FD-like
SwissprotQ84JK25e-40FD_ARATH; Protein FD
TrEMBLA0A0D2Q4X71e-129A0A0D2Q4X7_G
STRINGVIT_00s0349g00050.t015e-38(Vitis vinifera)
STRINGAT4G35900.11e-37(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19342772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.15e-19bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]