PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G111200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 297aa    MW: 33786.3 Da    PI: 7.991
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G111200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1163.7e-36101501128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.............kvka.eekewyfFskrdkkyatgkrknra 77 
                         +ppGfrFhPt+eel+ +yL+kkv+ + ++l +vi+evd++k+ PwdL+              k+ +  +++wy Fs+ ++++++ + +  +
  Gorai.002G111200.1  10 VPPGFRFHPTEEELLYYYLRKKVSFEVIDL-DVIREVDLNKLVPWDLKGhysyitlryadkcKIGSgPQNDWYCFSHIATRTRNIQPELEQ 99 
                         69****************************.9***************94589999998886644443456*********999988888889 PP

                 NAM  78 tksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         t + y katg+d++v+ ++++  g++ktLvfy+gra + +ktdW+mheyrl
  Gorai.002G111200.1 100 TGQPYLKATGRDRAVHLSNSKRGGMRKTLVFYTGRALHVQKTDWIMHEYRL 150
                         *************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.03E-356160IPR003441NAC domain
PROSITE profilePS5100534.3610165IPR003441NAC domain
PfamPF023651.6E-1911150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MATRNGQLSV PPGFRFHPTE EELLYYYLRK KVSFEVIDLD VIREVDLNKL VPWDLKGHYS  60
YITLRYADKC KIGSGPQNDW YCFSHIATRT RNIQPELEQT GQPYLKATGR DRAVHLSNSK  120
RGGMRKTLVF YTGRALHVQK TDWIMHEYRL DYDDSDQVQV WVKKTTWLTS GLLLLLLNWK  180
QGHNHLQASY DYSFDASINL PQLFSPESAA VASSFISPLS LNSMDIESSR NLLRQASTGG  240
SCGLMQQDQI SPSLQLDVGT SSQKVPFRYL GCEADILKIS KQLHLISDAY DFAFSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-25615011140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed at early heart stage onward in all root basal daughter cells resulting from horizontal divisions in the COL progenitors and is later maintained in these cells. Present in root stem cell daughters and accumulates in maturing root cap layers. Detectable from very early stages of lateral root development. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}.
UniprotTISSUE SPECIFICITY: Accumulates in maturing root cap cells, in both COL and LRC cells. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By FEZ in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022751588.11e-112protein SOMBRERO
SwissprotQ9MA171e-60SMB_ARATH; Protein SOMBRERO
TrEMBLA0A061FBQ81e-105A0A061FBQ8_THECC; NAC domain transcriptional regulator superfamily protein isoform 1
STRINGGorai.002G111200.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.37e-63NAC family protein
Publications ? help Back to Top
  1. Fendrych M, et al.
    Programmed cell death controlled by ANAC033/SOMBRERO determines root cap organ size in Arabidopsis.
    Curr. Biol., 2014. 24(9): p. 931-40
    [PMID:24726156]
  2. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]
  3. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  4. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]