PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G104500.1
Common NameB456_002G104500, LOC105782430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 176aa    MW: 19318.9 Da    PI: 7.8113
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G104500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260149.31e-46131121100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++lpe++r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq+++l+
  Gorai.002G104500.1  13 PCAACKLLRRRCAPDCVFAPYFPADEPQKFASVHKVFGASNVNKMLQELPEHQRRDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDSLQ 103
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++lal+++e
  Gorai.002G104500.1 104 NQLALAQAE 112
                         ****99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.24812113IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-4613110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MKENGRKNGA LSPCAACKLL RRRCAPDCVF APYFPADEPQ KFASVHKVFG ASNVNKMLQE  60
LPEHQRRDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID SLQNQLALAQ AEVVQMRMRQ  120
FGSTSSNPGT NSADENIASV ADAPSKFMPS HHQSKSFFCV DMVDQPNMAE SLWSY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ9082582e-89DQ908258.1 Gossypium hirsutum clone LIB5327-030-A1-N1-H9_Gh319 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012462623.11e-130PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE92e-70LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A0D2PXY11e-130A0A0D2PXY1_G
STRINGVIT_19s0027g01120.t012e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.11e-64LOB domain-containing protein 4
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]