PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G073700.1
Common NameB456_002G073700, LOC105779409
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 347aa    MW: 38429.1 Da    PI: 9.2016
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G073700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1691.6e-52141391128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF Ptdeel+v+yL++kv+g++++l ++i e+d+yk++PwdLp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk 
  Gorai.002G073700.1  14 LPPGFRFYPTDEELLVQYLCRKVAGHHFSL-QIIGEIDLYKFNPWDLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKI 103
                         79***************************9.89***************8777899***********************************9 PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  Gorai.002G073700.1 104 ITT-EGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 139
                         999.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-6610162IPR003441NAC domain
PROSITE profilePS5100560.70114162IPR003441NAC domain
PfamPF023654.1E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MGVPETDPLA QLSLPPGFRF YPTDEELLVQ YLCRKVAGHH FSLQIIGEID LYKFNPWDLP  60
SKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITTEGRK VGIKKALVFY  120
VGKAPKGTKT NWIMHEYRLI ETSRKSGSSK LDDWVLCRIY KKNSSGQKPL SSVSSREQST  180
NGSSSSSSSQ LDDMLESLPE LDDRFFALPR VNSFKTLQND VKLGFQSLGI GNLDWGSLGG  240
LSSVPELVPS GQPQTQTQSP GITSYGNSNV YVSTMPPTLC QMDVSTNKIG NSVEEEVQSG  300
LRTQRADNSG IFRQNSNVLN SHNFSNSIDP YGFRCPTQSG GFGFRQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-10911684171NO APICAL MERISTEM PROTEIN
1ut4_B1e-10911684171NO APICAL MERISTEM PROTEIN
1ut7_A1e-10911684171NO APICAL MERISTEM PROTEIN
1ut7_B1e-10911684171NO APICAL MERISTEM PROTEIN
4dul_A1e-10911684171NAC domain-containing protein 19
4dul_B1e-10911684171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.11200.0flower|seedling| flowering
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in guard cells of the epidermis. {ECO:0000269|PubMed:25005917}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU7063420.0EU706342.1 Gossypium hirsutum NAC domain protein NAC4 (NAC4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012458602.10.0PREDICTED: NAC domain-containing protein 72-like
SwissprotA0A3Q7HH641e-148JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBLA0A0D2M7X40.0A0A0D2M7X4_GOSRA; Uncharacterized protein
STRINGGorai.002G073700.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-129NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  3. Du M, et al.
    MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato.
    Plant Cell, 2017. 29(8): p. 1883-1906
    [PMID:28733419]
  4. Liu Y, et al.
    MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop.
    Plant Cell, 2019. 31(1): p. 106-127
    [PMID:30610166]