PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G068300.1
Common NameB456_002G068300, LOC105778902
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 183aa    MW: 20260.6 Da    PI: 8.6934
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G068300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP138.61.8e-4359135278
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         Cqve+C +dls ak+yhrrhkvCe+h+kapvv+v+g++qrfCqqCsrfhelsefDe+krsCr+rLa+hnerrrk++a
  Gorai.002G068300.1  59 CQVEKCGVDLSVAKRYHRRHKVCEIHAKAPVVVVAGIRQRFCQQCSRFHELSEFDEAKRSCRSRLAGHNERRRKSSA 135
                         **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114132.50556133IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.108.2E-3656120IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.8E-4057136IPR004333Transcription factor, SBP-box
PfamPF031101.1E-3359132IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MNKDFMAEDV DNDMEEEGGG EEEEEGAVYH GVQDDEKKKK ASGRRGSSGG VGGVLPPSCQ  60
VEKCGVDLSV AKRYHRRHKV CEIHAKAPVV VVAGIRQRFC QQCSRFHELS EFDEAKRSCR  120
SRLAGHNERR RKSSAESSAE GSSRKGTSPQ LKEGYCRQVD DQRARVPITI PGNSSFKRSH  180
IR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-3746132184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6147631e-167JX614763.1 Gossypium hirsutum clone NBRI_GE58393 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012458108.11e-131PREDICTED: squamosa promoter-binding protein 1
SwissprotQ9S7A94e-48SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLA0A0D2Q8V61e-131A0A0D2Q8V6_G
STRINGPOPTR_0001s40870.16e-67(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.11e-38squamosa promoter binding protein-like 5
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]