PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G064900.1
Common NameB456_002G064900, LOC105778517
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 321aa    MW: 35974.1 Da    PI: 7.0816
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G064900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1353.2e-11190235550
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                         kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  Gorai.002G064900.1 190 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQTEVSALSPRVA 235
                         8999*********************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.1E-14186250IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.703188240IPR004827Basic-leucine zipper domain
PfamPF001709.5E-10190235IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.6E-14190241No hitNo description
SuperFamilySSF579591.13E-11190244No hitNo description
CDDcd147032.22E-22191241No hitNo description
PROSITE patternPS000360193208IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MAQLPPKVPN MTQNWPSFPH QRLPTMANII STTANTATMN ASHHHQPSWV DEFLDFSSAR  60
RGAHRRSISD SIAFLEQPLV EECRDSNTNH NNNAMITETN VFDRLDDEQL MSMFSDDVAV  120
TMAAAPTLSS SNPSTPTSDQ NSNNDEKPVP SLDLQQPKNE PGEVESSCKP EPQAAQPPST  180
SNGDPIVDPK RVKRILANRQ SAQRSRVRKL QYISELERSV TTLQTEVSAL SPRVAFLDHQ  240
RLILNVDNSA LKQRIAALAQ DKIFKDAHQE ALKKEIERLR QVYQQQQSLK KMNSNNSNNH  300
HAPPQQQPSQ PQPTKKEEQL *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.250.0flower|seedling| flowering
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012457700.10.0PREDICTED: basic leucine zipper 61-like
SwissprotQ9M2K41e-110BZP61_ARATH; Basic leucine zipper 61
TrEMBLA0A0D2R1K80.0A0A0D2R1K8_G
STRINGVIT_19s0014g01780.t011e-128(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.24e-95bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]