PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G052400.1
Common NameB456_002G052400, LOC105777152
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family BES1
Protein Properties Length: 326aa    MW: 35119 Da    PI: 8.3612
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G052400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822212.11.4e-6521451150
              DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspe 91 
                         ++++r ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyr+g+kp e+++++g sa++sp+
  Gorai.002G052400.1   2 TSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWTVEPDGTTYRNGCKPVERMDIVGGSATVSPC 92 
                         5899*************************************************************************************** PP

              DUF822  92 sslqsslkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsssl 150
                         ss++        +s ++sy++sp+sssfpsp+s++ + + +   +sl+p+l++ls++sss+
  Gorai.002G052400.1  93 SSYH--------PSSRASYNPSPASSSFPSPASSSYMVNPNGdvNSLFPWLKNLSSASSSA 145
                         ****........999****************9988776665577**********9987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056879.1E-653139IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MTSGTRLPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCNEAG  60
WTVEPDGTTY RNGCKPVERM DIVGGSATVS PCSSYHPSSR ASYNPSPASS SFPSPASSSY  120
MVNPNGDVNS LFPWLKNLSS ASSSASSSKR PYSYIHGGSI SAPVTPPLSS PTARTPRMKN  180
DWEDQSVLPG WSAQQHSFLP SSTPPSPGRQ IVPDPEWFSG LQTPHSRPTS PTFSLVSSNP  240
FGFKEEVLAG GGSRMWTPGQ SGTCSPAIAA GLDQTADVPM SEVISDEFAF GSNATGLVKP  300
WEGERIHEEC GSDDLELTLG SSKTR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2431160.0AC243116.1 Gossypium raimondii clone GR__Ba0066P11-hvl, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012455701.10.0PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1
RefseqXP_012455718.10.0PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2
SwissprotQ9ZV881e-141BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A0D2NIJ80.0A0A0D2NIJ8_G
STRINGVIT_19s0014g00870.t011e-160(Vitis vinifera)
STRINGPOPTR_0001s39520.11e-162(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-126BES1/BZR1 homolog 4
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]