PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G037800.1
Common NameB456_002G037800, LOC105775871
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GeBP
Protein Properties Length: 391aa    MW: 42836 Da    PI: 5.0362
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G037800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573129.31.5e-40168264298
              DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifels 92 
                         lfqrl+se+Dei+lL+G++d+ ak+g++p +d++afy+fvkksi+ +v+k q+++KirrLKkKf+++  k k+g++ +fsk+h+q++fels
  Gorai.002G037800.1 168 LFQRLFSEDDEIALLKGMLDYSAKKGADPCADMNAFYNFVKKSIHTDVTKAQMMDKIRRLKKKFENNAGKGKKGEDRTFSKAHEQNAFELS 258
                         79***************************************************************************************** PP

              DUF573  93 kkiWgs 98 
                         k iWg+
  Gorai.002G037800.1 259 KLIWGK 264
                         ****95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.3E-34169263IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MAPKRSNPIE VPPAASSSEE DEEVTSSEEE EEGSSTEEED EEDPKTESTP LIQKSPPPRK  60
PETATPGVVN DESDESGSDS ESESDTATPN VKPLATKPME ESLNAKKPRS NKPLTSPIRA  120
SSSKRPGELE LDAKEAKRPK KKVGEEGLAT TPAVEEVKKT GEDAKKQLFQ RLFSEDDEIA  180
LLKGMLDYSA KKGADPCADM NAFYNFVKKS IHTDVTKAQM MDKIRRLKKK FENNAGKGKK  240
GEDRTFSKAH EQNAFELSKL IWGKEGISGK VESSAAKSNG KAKGNNKAVV ALKAEFSSPD  300
KKTYDAVPIE ADKVVSKSSG SLFDKRFGVS DMEEAVVKLG LDMVDGEKKA ALEAKWRKLQ  360
IAQLELFVER SELVTEQAKL VLEYYKSEEK *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ7512650.0JQ751265.1 Gossypium hirsutum GL1-enhancer binding protein (GeBP) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012453826.10.0PREDICTED: mediator-associated protein 1-like isoform X1
TrEMBLA0A0D2Q0C70.0A0A0D2Q0C7_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.18e-40DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]