PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G022300.1
Common NameB456_002G022300, LOC105774405
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CO-like
Protein Properties Length: 471aa    MW: 51472.5 Da    PI: 5.8223
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G022300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.11.3e-061251437
            zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                          C+ ++e+ + l+C+ ++  lC  C ++ H+       H
  Gorai.002G022300.1 12 VPCDFCNEQIAVLYCRADSAKLCLFCDQHVHSAnllsrkH 51
                        57***************************99555565556 PP

2zf-B_box22.81.9e-075496339
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                         ++C+++++++++  C +++  lC++C    H +      H++
  Gorai.002G022300.1 54 SQICDNCSSEPVSVLCSTDNLVLCQECDWDAHGScsvsaaHDR 96
                        689************************9999944777777765 PP

3CCT64.24e-22422465144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         R +a++RYkeK+ktR+++K+irYesRKa+A++R+RvKGrFvk++
  Gorai.002G022300.1 422 RGNAMQRYKEKKKTRRYDKHIRYESRKARADTRKRVKGRFVKAT 465
                         7789**************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.5E-13956IPR000315B-box-type zinc finger
PROSITE profilePS501199.855956IPR000315B-box-type zinc finger
CDDcd000213.21E-71244No hitNo description
PROSITE profilePS501199.5275299IPR000315B-box-type zinc finger
CDDcd000214.61E-65685No hitNo description
SMARTSM003360.995799IPR000315B-box-type zinc finger
PfamPF062031.8E-16422464IPR010402CCT domain
PROSITE profilePS5101714.912422464IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MVSPVSEGKG AVPCDFCNEQ IAVLYCRADS AKLCLFCDQH VHSANLLSRK HVRSQICDNC  60
SSEPVSVLCS TDNLVLCQEC DWDAHGSCSV SAAHDRTLVE GFSGCPSALE LASVWGFDLE  120
EKKTTDRNWN VCHQDLMMPA VESWLYETSL QEMMVPYESF GCYGETLKKQ NTGSGKCKQV  180
IYKQLVELMK RDLMCGGGGE GVGDGGGGGG GEENLASNVE QNGGFLTQQE VLQPLPEPGT  240
ETQTQALFTS LLMMQTQESE RIVNGGNVVL NGNPNNQTSQ IWDFKLGRLR GQEECSQSRL  300
EEEVGYGGDA AFVIKNFSQC MKETSLTDNG NLMGYPPSKH DLASLNNNDS NHPGASQGPS  360
TSESNNLPIP KPSSGSALGK PKGSTGCNDV HFSEQPFLVR PVDHTTLTAT SKADRELLAQ  420
NRGNAMQRYK EKKKTRRYDK HIRYESRKAR ADTRKRVKGR FVKATEAPDD *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6183330.0JQ618333.1 Gossypium hirsutum constans-like protein 3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012452351.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 14-like
TrEMBLA0A0D2M5U90.0A0A0D2M5U9_G
STRINGVIT_01s0146g00360.t011e-167(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38712647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.21e-111B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]