PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G008500.1
Common NameB456_002G008500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 551aa    MW: 60509.4 Da    PI: 4.6241
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G008500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM138.44.4e-431943202128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         ppG+rF Ptdeel+++yL kkv+++ l+  + i evd+y +eP +L +    ++e+ewyfF++r+kky++g r+ r+t++g+Wk tg dk+
  Gorai.002G008500.1 194 PPGVRFVPTDEELIQYYLLKKVNNELLPS-NLIWEVDLYGTEPAKLTEsYEPNGESEWYFFTSRRKKYPNGGRPDRSTENGFWKPTGMDKS 283
                         9*************************999.89**************8514445778*********************************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         + + + + +g kktL f++gr+p+g+kt+W mhey++
  Gorai.002G008500.1 284 IPEGGLKPIGSKKTLEFHTGRHPSGHKTEWKMHEYKV 320
                         ***99999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-48191348IPR003441NAC domain
PROSITE profilePS5100548.422193348IPR003441NAC domain
PfamPF023651.4E-23194319IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    Send to blast
MAANIENQND ISNPLIASNM GATVLEGGEI VTTTENEDYN NILIYSAATD GGAIAYEDSE  60
FATMMEDVFN QNSTLSCFAA ADGGATAYEV GQFFTQEEDI YNLNSVLNST VASNIDVTAF  120
EGGQFFTQEE NIYDQINVLS STVASNIETT AFEGGETVTT AENANNRNNM LNSSTASHGG  180
RTVAEVKDYI QSFPPGVRFV PTDEELIQYY LLKKVNNELL PSNLIWEVDL YGTEPAKLTE  240
SYEPNGESEW YFFTSRRKKY PNGGRPDRST ENGFWKPTGM DKSIPEGGLK PIGSKKTLEF  300
HTGRHPSGHK TEWKMHEYKV DPSLIKPQNK PQDGMTLDTC VLCKVYKTQR KGQNENYIAS  360
CDQNTNTSSS SQIFDAGASS EATNVSYPMT GFAGQPDSEL YPLTTSPMPN YEYYSNTWFQ  420
PTVDGALNNE AFVPAANRNN TVFRNRNSDT TWPPYHPYYS NGLLLHRGVN NAASTSTVAG  480
NYIDNNVRAL QVRPPNAAMT QLTVNNGGPN SEDHSMAASR SNTMSRGRGE AQRGSRRGGN  540
RGKIIMLPRG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-4019235114171Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012468594.10.0PREDICTED: uncharacterized protein LOC105786622
TrEMBLA0A0D2M5500.0A0A0D2M550_GOSRA; Uncharacterized protein
STRINGGorai.002G008500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2427034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.22e-42NAC domain containing protein 47
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]