PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G001900.1
Common NameB456_002G001900, LOC105772605
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 280aa    MW: 32349.1 Da    PI: 9.1846
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G001900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.61.5e-46121383128
                 NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                         pGfrFhPt+eel+ +yL++ v gk l+  +vi  ++iy+++PwdLp   k +e+ewyfF++ d+k+ +g r+nr+tk+g+Wkatg+d++++
  Gorai.002G001900.1  12 PGFRFHPTEEELLEFYLRNIVYGKMLSY-DVIGFLNIYHHDPWDLPGLSKVGEREWYFFVPIDRKHGKGGRPNRTTKNGFWKATGSDRKIV 101
                         9************************999.99***************8778899*************************************9 PP

                 NAM  94 sk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         s   +++ +g kktLvfykgra++g ktdWvm+eyrl
  Gorai.002G001900.1 102 SLsdQKKMIGFKKTLVFYKGRAQRGCKTDWVMNEYRL 138
                         98667788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-549155IPR003441NAC domain
PROSITE profilePS5100552.68910155IPR003441NAC domain
PfamPF023651.0E-2412138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MSYQSNPEVE LPGFRFHPTE EELLEFYLRN IVYGKMLSYD VIGFLNIYHH DPWDLPGLSK  60
VGEREWYFFV PIDRKHGKGG RPNRTTKNGF WKATGSDRKI VSLSDQKKMI GFKKTLVFYK  120
GRAQRGCKTD WVMNEYRLPD ATLPKDIVMC KVYRKATSLK VLEQRAAMEE ELKNTSLPSS  180
SSFSSMDTIS FCTPKQDLVV FKKEEDEEAM VKEKRSDGIA KEQKKISSAS LQLPLGNENM  240
GQLQIPKMLT DWTQDQFWAQ LNSPWFQNLT PYVANILNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-4511553168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472340.0KC847234.1 Gossypium hirsutum NAC domain protein NAC57 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001314221.10.0putative NAC domain-containing protein 94
RefseqXP_012449436.10.0PREDICTED: protein FEZ-like
RefseqXP_012449442.10.0PREDICTED: protein FEZ-like
SwissprotQ10S659e-91NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A0D2PYL50.0A0A0D2PYL5_GOSRA; Uncharacterized protein
TrEMBLW6JBA70.0W6JBA7_GOSHI; NAC domain protein NAC57
STRINGGorai.002G001900.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38992860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.11e-104NAC domain containing protein 36
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]