PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G254300.1
Common NameB456_001G254300, LOC105767826
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 295aa    MW: 34068.1 Da    PI: 6.5898
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G254300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.53.8e-51101381129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF P+deelv++yL kk++++++    ++ e+d++++ePw+Lp+ +k + +ewyfFs rd+kyatg r+nrat+sgyWkatgkd++
  Gorai.001G254300.1  10 LPPGFRFYPSDEELVCHYLYKKIANEEVLK-GTLVEIDLHTCEPWQLPEVAKLNANEWYFFSFRDRKYATGFRTNRATTSGYWKATGKDRT 99 
                         79*************************655.78***************88888999*********************************** PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                         v++  ++++vg++ktLvfy++rap+g kt W+mhe+rle
  Gorai.001G254300.1 100 VVDPrTQQVVGMRKTLVFYRNRAPNGIKTGWIMHEFRLE 138
                         **9966777***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-618156IPR003441NAC domain
PROSITE profilePS5100558.03610156IPR003441NAC domain
PfamPF023659.0E-2811137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELVCHYLYK KIANEEVLKG TLVEIDLHTC EPWQLPEVAK  60
LNANEWYFFS FRDRKYATGF RTNRATTSGY WKATGKDRTV VDPRTQQVVG MRKTLVFYRN  120
RAPNGIKTGW IMHEFRLETP HMPPKEDWVL CRVFHKSKGA ENSTRLSSPM MLEPSIHAPS  180
LADHTTMACG YHHQINSLAT KPAHQSHSQS LLNLLQYNSH QENDDDDKNN NNLHCSNNEV  240
SSKVDDDYEF LWDMNMEENS LGDDHHHHHR HLIHGVASNS DDMRFEIDNS MIFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-48916216171NO APICAL MERISTEM PROTEIN
1ut4_B1e-48916216171NO APICAL MERISTEM PROTEIN
1ut7_A1e-48916216171NO APICAL MERISTEM PROTEIN
1ut7_B1e-48916216171NO APICAL MERISTEM PROTEIN
4dul_A1e-48916216171NAC domain-containing protein 19
4dul_B1e-48916216171NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in the root tip and in lateral root initiation sites. Also detected in expanding cotyledon, and in leaf primordia. {ECO:0000269|PubMed:11114891}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9141480.0JQ914148.1 Gossypium hirsutum NAC domain protein 17 (NAC17) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012442853.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
SwissprotQ84TE64e-63NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A0D2M3120.0A0A0D2M312_GOSRA; Uncharacterized protein
STRINGGorai.001G254300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34362862
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.12e-94NAC domain containing protein 74
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  6. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  7. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]