PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G251000.1
Common NameB456_001G251000, LOC105767585
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 198aa    MW: 22487.2 Da    PI: 6.3092
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G251000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.11.1e-1482140563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         +++rr+++NRe+ArrsR RK++ ++eL   v  L +eN++L ++l++ ++  +++ +e+
  Gorai.001G251000.1  82 RKQRRMISNRESARRSRMRKQKHLDELWSQVIRLRNENQSLLDKLNHVSESHDRVLQEN 140
                         79**********************************************99998888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.880.104.9E-54296IPR008917Transcription factor, Skn-1-like, DNA-binding domain
SMARTSM003381.4E-1678142IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.17480143IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.06E-1382132No hitNo description
PfamPF001702.1E-1282140IPR004827Basic-leucine zipper domain
CDDcd147022.10E-1983134No hitNo description
PROSITE patternPS00036085100IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-1297155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MVPVEFRGLH YLAPENPILI PANLGMMQNS IPSFHFNTFE SSLPNSHIVP SAQEFAALSS  60
SISNTSTSDE AEEQQVNVID ERKQRRMISN RESARRSRMR KQKHLDELWS QVIRLRNENQ  120
SLLDKLNHVS ESHDRVLQEN ARLKEEASDL RQMLTDLKIG SPYSLAFRDL EEVPCNTAHL  180
KAESTNQSIA NSVDLLH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194101RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012442613.11e-143PREDICTED: basic leucine zipper 43-like
TrEMBLA0A0D2PWI51e-143A0A0D2PWI5_G
STRINGVIT_01s0010g00930.t017e-93(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31122667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.11e-46basic leucine-zipper 42
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]