PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G223800.2
Common NameB456_001G223800, LOC105803687
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CO-like
Protein Properties Length: 409aa    MW: 44601.3 Da    PI: 4.8118
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G223800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.62.2e-07444539
            zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                        +C+ +++++ + +C+++  +lC +C  + H+       H++
  Gorai.001G223800.2  4 ICDFCGNQPSTVYCQSDAACLCLSCDRNVHSAnalskrHSR 44
                        7*****************************65677777765 PP

2zf-B_box21.16.3e-074689441
            zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Htvvp 41
                          C++++++++   C + ++ lC++C   +H g       H++++
  Gorai.001G223800.2 46 LLCERCNSQPAFVRCVEERVSLCQNCDWMGH-GtstlnstHRRQT 89
                        57*****************************.5477888887765 PP

3CCT639.5e-22351394144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         R  a++RYkeK+ktRkFeK++rY+sRKa+A+ R+RvKGrFvk+ 
  Gorai.001G223800.2 351 RSDAVMRYKEKKKTRKFEKRVRYASRKARADVRKRVKGRFVKAG 394
                         889**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.499147IPR000315B-box-type zinc finger
CDDcd000211.11E-8447No hitNo description
SMARTSM003365.6E-9447IPR000315B-box-type zinc finger
PfamPF006431.5E-5444IPR000315B-box-type zinc finger
PROSITE profilePS501198.7024390IPR000315B-box-type zinc finger
CDDcd000211.25E-54790No hitNo description
SMARTSM003360.264890IPR000315B-box-type zinc finger
PfamPF062032.0E-16351393IPR010402CCT domain
PROSITE profilePS5101715.418351393IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MGYICDFCGN QPSTVYCQSD AACLCLSCDR NVHSANALSK RHSRTLLCER CNSQPAFVRC  60
VEERVSLCQN CDWMGHGTST LNSTHRRQTI NCYSGCPSSA ELSSIWSFFS QSPSAGESTC  120
EQELRQMSIT ETSWCPTENT ISQNDTGDAE VNRDYNVDRG SSWSGSSIPE LRSGPGLLDQ  180
PAGTTDTSLS ELSCPQTKCP GVCKDDLYDD FNMDEIDLNL EKYEELFGVT LNHSEELFGN  240
GGIDSLFGTK DMSATDSYQG AVAAEGSSVG LVNAIQPACS NAASADSMMS NKTNSILCFT  300
ARQDHSSFSF SGLTGESSGG DYQDCGASSM LLMGEAPWCP PSEVPFSSAT RSDAVMRYKE  360
KKKTRKFEKR VRYASRKARA DVRKRVKGRF VKAGDDYDYD PLNPTRSC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.9230.0seedling
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO487421650.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012491505.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9 isoform X1
RefseqXP_012491516.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9 isoform X1
SwissprotQ9SSE51e-148COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A0D2PVD30.0A0A0D2PVD3_G
STRINGGLYMA20G07051.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-111CONSTANS-like 9
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]