PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G190000.1
Common NameB456_001G190000, LOC105799496
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CO-like
Protein Properties Length: 409aa    MW: 44119 Da    PI: 4.9385
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G190000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.39.7e-06444539
            zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                        +C+ ++++    +C+++  +lC +C  + H+       H++
  Gorai.001G190000.1  4 ICDFCGDQLSMVYCRSDAACLCLSCDRNVHSAnalsrrHSR 44
                        7*******9*********************65677777766 PP

2zf-B_box20.78.7e-074689441
            zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Htvvp 41
                          C++++++++   C + ++ lC++C   +H g       H++++
  Gorai.001G190000.1 46 LLCERCNSQPAFVRCAEERVSLCQNCDWIGH-GastsnstHKRQT 89
                        57*****************************.5578888888776 PP

3CCT67.82.8e-23351394144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         R +a++RYkeK+ktRkF+K++rY+sRKa+A+ R+RvKGrFvk+ 
  Gorai.001G190000.1 351 RSNAVMRYKEKKKTRKFDKQVRYASRKATADVRKRVKGRFVKAG 394
                         899**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.542147IPR000315B-box-type zinc finger
SMARTSM003364.4E-8447IPR000315B-box-type zinc finger
CDDcd000211.98E-6447No hitNo description
PROSITE profilePS501198.8164390IPR000315B-box-type zinc finger
CDDcd000218.89E-54790No hitNo description
SMARTSM003360.684890IPR000315B-box-type zinc finger
PfamPF062031.3E-17351393IPR010402CCT domain
PROSITE profilePS5101715.398351393IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MGYICDFCGD QLSMVYCRSD AACLCLSCDR NVHSANALSR RHSRTLLCER CNSQPAFVRC  60
AEERVSLCQN CDWIGHGAST SNSTHKRQTI NCYSGCPSSS ELSSMWSFFP QSPPAGESSC  120
EQELGLMCIT ENIERTSWGA IENTINQNSA GVAEVNHDSN TDKGIGWGGT SSIPDLRSMP  180
RVLDQPPGPT GASLPKCPGI CEDALYDDFN MDEVDLNLEN YEELFGVTLN HSEELLGNGG  240
IDSLFGTKDM AAADSNCQGA LAAEGSSVGL INAIQPDCSN AASADSMMSS KTDSILCFTA  300
RQAHSSVSFS GLTGESSAGD YQDCGSSSML LMGEPSWCPP CAESSFQSAT RSNAVMRYKE  360
KKKTRKFDKQ VRYASRKATA DVRKRVKGRF VKAGDAYDYD PLNHTRSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485544.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like isoform X1
RefseqXP_012485552.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like isoform X1
RefseqXP_012485560.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like isoform X1
SwissprotQ9SSE51e-152COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A0D2PTN40.0A0A0D2PTN4_G
STRINGGLYMA13G11592.10.0(Glycine max)
STRINGGLYMA20G07051.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16822786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-137CONSTANS-like 9
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]