PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G150000.4
Common NameB456_001G150000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 467aa    MW: 53408.8 Da    PI: 5.3849
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G150000.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM130.99.5e-4161302128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                           GfrF P dee+++++Lkkk+ g++ ++ + i+evd++k+ePw+Lp +  v+++  ew+fF k +k ++  +++ r+t++gyWk+tg d+
  Gorai.001G150000.4   6 EIGFRFLPPDEEIISFFLKKKMMGDHKTT-RYIREVDLLKHEPWQLPaMsVVQSTYPEWFFFYKLSKISQ--RKNDRSTNDGYWKSTGADR 93 
                         68***********************9777.89***************5334555555*******999765..58889************** PP

                 NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++++ +++l+g+kktLvfykgr+p+g +tdWvmhe+r+
  Gorai.001G150000.4  94 PITC-GDSLIGTKKTLVFYKGRTPNGLRTDWVMHEFRA 130
                         ****.999****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-424135IPR003441NAC domain
PROSITE profilePS5100541.855146IPR003441NAC domain
PfamPF023652.4E-207129IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MDNVLEIGFR FLPPDEEIIS FFLKKKMMGD HKTTRYIREV DLLKHEPWQL PAMSVVQSTY  60
PEWFFFYKLS KISQRKNDRS TNDGYWKSTG ADRPITCGDS LIGTKKTLVF YKGRTPNGLR  120
TDWVMHEFRA TADSLPPNAQ CTRFAASSSQ DNAVGATSME SNSADFDIAL RMYMEEEGMF  180
DSDLSPSGGL HCFPSSSAIF NNDQSRIEEE RFSLEDFDYL QSDDLFDDEN EWQRQFVNTI  240
DDEMEFYGAL FHNPDERTNA EAEYRDNAWH DQIVHMSDGT CHGHSEGLNQ RRMETGVHHD  300
EVLIMDSGVE SATVTAYEIN CLELVQEERS VNSRACKSEY KPISHKSAVL RHPRRVQLQD  360
KSLGKAVSRD KTRESGIRGP AVQPIQDKKS ILQANEGPKM DRDRNTKLIV NWRSEGSSGS  420
SRKNSFNFVE MSQLSCKADP ALVYFRNLVL GLILFVVLVR EVMFLR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-28512915139Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472500.0KC847250.1 Gossypium hirsutum NAC domain protein NAC73 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480538.10.0PREDICTED: protein NTM1-like 9
TrEMBLA0A0D2N9W80.0A0A0D2N9W8_GOSRA; Uncharacterized protein
STRINGGorai.001G150000.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.16e-40NAC transcription factor-like 9
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]