PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G144200.1
Common NameB456_001G144200, LOC105794820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 138aa    MW: 15639.9 Da    PI: 7.1928
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G144200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.75.9e-141571460
                        XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60
                         ++ +r+ +NRe+ArrsR RK++++e L ++v +L++ N++L ++++  ++ +a+++
  Gorai.001G144200.1 15 ERKRKRMLSNRESARRSRIRKQKQLEDLVNEVSALQKDNSQLSEKINVATQRYAEME 71
                        5678999*****************************************999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.1E-12862No hitNo description
SMARTSM003381.7E-151276IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.991471IPR004827Basic-leucine zipper domain
PfamPF001708.2E-121671IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.75E-121668No hitNo description
CDDcd147022.85E-181768No hitNo description
PROSITE patternPS0003601934IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006971Biological Processhypotonic response
GO:0009267Biological Processcellular response to starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MAAVQRPASS SDSDERKRKR MLSNRESARR SRIRKQKQLE DLVNEVSALQ KDNSQLSEKI  60
NVATQRYAEM ECANNVLRAQ AMELTERLRS LNSVLHIVEE VSGYAVDIPE IPDPLMKPWQ  120
IPCPVQPIMA LADMFEC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11536RKRKRMLSNRESARRSRIRKQK
22835RRSRIRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00419DAPTransfer from AT3G62420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012479627.13e-96PREDICTED: ocs element-binding factor 1-like
SwissprotQ9LZP84e-62BZP53_ARATH; bZIP transcription factor 53
TrEMBLA0A0D2PQN03e-96A0A0D2PQN0_G
STRINGPOPTR_0002s19720.12e-63(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30362763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.16e-62basic region/leucine zipper motif 53
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]