PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G131300.1
Common NameB456_001G131300, LOC105793589
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YC
Protein Properties Length: 244aa    MW: 27852.6 Da    PI: 10.2978
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G131300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC41.13.9e-1313722611100
               NF-YC  11 ekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprde 100
                         e++++ k  ++P+ rik+i+k+++    +s ++  l+ ka elf+ ++    +  + + ++++l    ++++v + + +dfl d vp+++
  Gorai.001G131300.1 137 EEEEEAKVCRFPMNRIKRIIKTEDSHMAVSQDVVFLVNKAAELFLEKFCEDGYKCSIKDRKKSLSYKHLSTVVHEQKRYDFLSDYVPQKK 226
                         6677889999***************9*************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.11E-16143224IPR009072Histone-fold
PfamPF008085.1E-14146209IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.103.2E-22147224IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MALDIRSMEF GVEIFRNLRE RERESAMASS SKKPKEENKK KKNKEKSNRT ADKDTKKSIK  60
KPEKKASASK TPTKSKPNPE SKPDKSKNKS SNGIPVKSQV IADPSSSSES EPQENRNNSH  120
KNVKPNSKRK RKEEVDEEEE EAKVCRFPMN RIKRIIKTED SHMAVSQDVV FLVNKAAELF  180
LEKFCEDGYK CSIKDRKKSL SYKHLSTVVH EQKRYDFLSD YVPQKKKAED ALKVMNLAET  240
GEG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012477933.11e-175PREDICTED: DNA polymerase epsilon subunit C
TrEMBLA0A0D2QPX41e-174A0A0D2QPX4_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.12e-31nuclear factor Y, subunit C10
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]