PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G129700.1
Common NameB456_001G129700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 282aa    MW: 31404.9 Da    PI: 8.7764
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G129700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.91.5e-421192181100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l+
  Gorai.001G129700.1 119 PCAACKILRRRCAEKCVLAPYFPPTEPTKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEASARIRDPVYGCTGAICQLQKQVNELQ 209
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         a+la++++e
  Gorai.001G129700.1 210 AQLAKAQAE 218
                         ****99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.238118219IPR004883Lateral organ boundaries, LOB
PfamPF031957.5E-43119216IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MTSRPRQQVA LTWTRCPVTY PDIALTWTRF CGKWPIPYKK GGTPPHHHHH YHHYHIHSIS  60
LKLRNKESIS VSLVLYPNPP PMLKMEYTSE VAAQSPSPKS SNSSSSPPPP PSTSVVISPC  120
AACKILRRRC AEKCVLAPYF PPTEPTKFTI AHRVFGASNI IKFLQELPES QRADAVSSMV  180
YEASARIRDP VYGCTGAICQ LQKQVNELQA QLAKAQAEVV NMQLQQANLV ALLCMEVAQS  240
PQQNPHQPIN DFLSNSPQSY HSNPSFLDDN NLGSSWEPLW T*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6158951e-117JX615895.1 Gossypium hirsutum clone NBRI_GE60161 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012477807.11e-144PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR04e-74LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0D2LY540.0A0A0D2LY54_G
STRINGGLYMA11G15810.11e-95(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-64LOB domain-containing protein 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]