PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G122800.1
Common NameB456_001G122800, LOC105792817
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 247aa    MW: 28352.7 Da    PI: 6.0575
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G122800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM150.21e-4641342128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         p+GfrF Pt+eelv++yL+++++g++ e+++vi+ ++iy+vePwdLp+    +++ ++++w++F++r++++a+g r+nr+t+sgyWkatg+
  Gorai.001G122800.1   4 PAGFRFFPTEEELVSFYLRNQLDGRRQEMHSVIPVLNIYDVEPWDLPQlageRCRRDTEQWFYFTPRQEREARGGRANRTTASGYWKATGS 94 
                         89***************************999***************656666666788******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            v+s++++++g+kkt+vfykg+ap+g+kt+W m+eyr+
  Gorai.001G122800.1  95 PSYVYSSDDRVIGMKKTMVFYKGKAPSGKKTKWKMNEYRA 134
                         **************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-492161IPR003441NAC domain
PROSITE profilePS5100548.6923162IPR003441NAC domain
PfamPF023652.3E-234133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MEIPAGFRFF PTEEELVSFY LRNQLDGRRQ EMHSVIPVLN IYDVEPWDLP QLAGERCRRD  60
TEQWFYFTPR QEREARGGRA NRTTASGYWK ATGSPSYVYS SDDRVIGMKK TMVFYKGKAP  120
SGKKTKWKMN EYRAIEAVPN PTAVTTTPML RHEFSLCRIY VVSGSFRAFD RRPLEPVSKA  180
TQLHENRTAT FSERASMMEV TSSSSTSHTG GDHSDQPEAN EDDIWEMVND LEEPPLGWEQ  240
MNWTGV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-33116013166Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC1106480.0KC110648.1 Gossypium hirsutum NAC protein 13 (NAC13) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012477074.10.0PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR31e-90NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A0D2QPI20.0A0A0D2QPI2_GOSRA; Uncharacterized protein
STRINGGorai.001G122800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14452893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44350.25e-88NAC domain containing protein 61
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]