PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G091900.2
Common NameB456_001G091900, LOC105789451
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 334aa    MW: 38319 Da    PI: 8.4038
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G091900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.12.2e-46191662128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                          pGfrFhPtdeelv +yL++kve+k++++ e ik++diy+++PwdLp   + +eke yf++kr +ky+++ r+nr+t sg+Wkatg dk++
  Gorai.001G091900.2  19 LPGFRFHPTDEELVGFYLRRKVEKKPISI-ELIKQIDIYQYDPWDLP-ISNVGEKERYFYCKRGRKYRNSIRPNRVTGSGFWKATGIDKPI 107
                         59***************************.89***************.4456899************************************ PP

                 NAM  93 lskkgel.......................vglkktLvfykgrapkgektdWvmheyrl 128
                         +s+++++                       +glkk+Lv+y+g a kg+ktdW+mhe+rl
  Gorai.001G091900.2 108 YSSSTKEphhhhhhhhhqhdrhqhqhlctcIGLKKSLVYYRGCAGKGTKTDWMMHEFRL 166
                         **83333555666777788899999********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100546.33318190IPR003441NAC domain
SuperFamilySSF1019412.88E-4719189IPR003441NAC domain
PfamPF023651.7E-2320166IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005992Biological Processtrehalose biosynthetic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006561Biological Processproline biosynthetic process
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0010120Biological Processcamalexin biosynthetic process
GO:0042538Biological Processhyperosmotic salinity response
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MEDSIDDNKK KRDGEEIKLP GFRFHPTDEE LVGFYLRRKV EKKPISIELI KQIDIYQYDP  60
WDLPISNVGE KERYFYCKRG RKYRNSIRPN RVTGSGFWKA TGIDKPIYSS STKEPHHHHH  120
HHHHQHDRHQ HQHLCTCIGL KKSLVYYRGC AGKGTKTDWM MHEFRLPPNG NHTTKAQEAE  180
VWTLCRIFKR TPPNNKYPPT TVASTAAWKF SATTTIKQSG TDSPTTCCSS LEDVSQSQNS  240
YDKCKSLCDT IIQQKGNKPD MSMDQVDARN YFLYGGTLPL STQQAPFTAT NFPTFCNHPS  300
GDVDVFSNGN WDELRPVVEV ALEPYTSHAF DFT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-432019019165NO APICAL MERISTEM PROTEIN
1ut4_B3e-432019019165NO APICAL MERISTEM PROTEIN
1ut7_A3e-432019019165NO APICAL MERISTEM PROTEIN
1ut7_B3e-432019019165NO APICAL MERISTEM PROTEIN
3swm_A4e-432019022168NAC domain-containing protein 19
3swm_B4e-432019022168NAC domain-containing protein 19
3swm_C4e-432019022168NAC domain-containing protein 19
3swm_D4e-432019022168NAC domain-containing protein 19
3swp_A4e-432019022168NAC domain-containing protein 19
3swp_B4e-432019022168NAC domain-containing protein 19
3swp_C4e-432019022168NAC domain-containing protein 19
3swp_D4e-432019022168NAC domain-containing protein 19
4dul_A3e-432019019165NAC domain-containing protein 19
4dul_B3e-432019019165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00310DAPTransfer from AT2G43000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012472289.10.0PREDICTED: transcription factor JUNGBRUNNEN 1 isoform X2
TrEMBLA0A0D2PP440.0A0A0D2PP44_GOSRA; Uncharacterized protein
STRINGGorai.001G091900.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.14e-84NAC domain containing protein 42
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]