PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G074200.1
Common NameB456_001G074200, LOC105787862
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family M-type_MADS
Protein Properties Length: 366aa    MW: 41707.2 Da    PI: 6.8254
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G074200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.77.4e-24953145
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                        kr e++snrqvt+skRr+gilKKA+ELS+LCd+ + +++fs+tgk
  Gorai.001G074200.1  9 KRLESYSNRQVTYSKRRTGILKKAKELSILCDIHIILLMFSPTGK 53
                        689****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-30160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.077161IPR002100Transcription factor, MADS-box
CDDcd002663.01E-26282No hitNo description
SuperFamilySSF554552.35E-25294IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-18323IPR002100Transcription factor, MADS-box
PfamPF003193.4E-201156IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MGRVKLKIKR LESYSNRQVT YSKRRTGILK KAKELSILCD IHIILLMFSP TGKPTLFHGE  60
RSNIEEVIVK FAQLTPQERA KRKLESLEAL KKTFMKLDHD LNIHDFLGAN SQSIEEMTKE  120
VSRFRAQLAE VHKRLSYWSN PDKIDNIEHL RQMEDSLRES IERVRIHKEN FGKHHLMSLE  180
CCNQFQNRIP LSVMIGAVQE AQPVMWLPNN ENHHTLLHNE LNFLPHRDAE CSTDCSLAGY  240
SGFFGSGKQT EISSSGQVDN VVQECNALNE LGSNACLNLE PGEQYFYQPY SASNYQDDEK  300
LKTEMEVNLQ GNPVVNQVIS NFEIPRPMYN NGHQAWVLSS GPCGIAMFDG NSYHQTPSSG  360
QCHDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-14192190Myocyte-specific enhancer factor 2B
1tqe_Q1e-14192190Myocyte-specific enhancer factor 2B
1tqe_R1e-14192190Myocyte-specific enhancer factor 2B
1tqe_S1e-14192190Myocyte-specific enhancer factor 2B
6c9l_A1e-14192190Myocyte-specific enhancer factor 2B
6c9l_B1e-14192190Myocyte-specific enhancer factor 2B
6c9l_C1e-14192190Myocyte-specific enhancer factor 2B
6c9l_D1e-14192190Myocyte-specific enhancer factor 2B
6c9l_E1e-14192190Myocyte-specific enhancer factor 2B
6c9l_F1e-14192190Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM2364490.0HM236449.1 UNVERIFIED: Gossypium hirsutum MADS33-like mRNA, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469941.10.0PREDICTED: MADS-box transcription factor 57-like isoform X4
SwissprotQ7X9I01e-105AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A0D2N6M00.0A0A0D2N6M0_GOSRA; Uncharacterized protein
STRINGGorai.001G074200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59332543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.15e-99AGAMOUS-like 65
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]