PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G048200.1
Common NameB456_001G048200, LOC105785150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 336aa    MW: 39102.9 Da    PI: 6.927
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G048200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.25.4e-5671361129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPtdeelv +yL+kk+++++++l +vik+vd+yk+ePwdL++  ++ + e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+
  Gorai.001G048200.1   7 VPPGFRFHPTDEELVAYYLRKKITSRRIDL-DVIKDVDLYKIEPWDLQElcRIGTeEQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGR 96 
                         69****************************.9***************954555442556******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         dk+++s k+ l+g++ktLvfykgrap+g+k+dW+mheyrle
  Gorai.001G048200.1  97 DKAIYS-KHDLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                         ******.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.5E-625156IPR003441NAC domain
PROSITE profilePS5100560.1437156IPR003441NAC domain
PfamPF023658.9E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MNAFSQVPPG FRFHPTDEEL VAYYLRKKIT SRRIDLDVIK DVDLYKIEPW DLQELCRIGT  60
EEQNEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI YSKHDLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN GTPQEEGWVV CRVFKKRIPA INKVSEYESP CWYDDQVTFN  180
PDLASPMQNM AYHHLPYSCK KELDLQYQAP NEHYLQLPLL DSPKLLHPPV EAFGLDINNA  240
STLQETHEQH LQTLYANTNN EHAADQVTDW RILDKFVASQ LSREEVAKQN NYSSASAKNV  300
FHSSQHANLL IRHLNKQEMV PENASTSNRH TDLWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-50716017169NO APICAL MERISTEM PROTEIN
1ut4_B5e-50716017169NO APICAL MERISTEM PROTEIN
1ut7_A5e-50716017169NO APICAL MERISTEM PROTEIN
1ut7_B5e-50716017169NO APICAL MERISTEM PROTEIN
3swm_A6e-50716020172NAC domain-containing protein 19
3swm_B6e-50716020172NAC domain-containing protein 19
3swm_C6e-50716020172NAC domain-containing protein 19
3swm_D6e-50716020172NAC domain-containing protein 19
3swp_A6e-50716020172NAC domain-containing protein 19
3swp_B6e-50716020172NAC domain-containing protein 19
3swp_C6e-50716020172NAC domain-containing protein 19
3swp_D6e-50716020172NAC domain-containing protein 19
4dul_A5e-50716017169NAC domain-containing protein 19
4dul_B5e-50716017169NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniprotTISSUE SPECIFICITY: Expressed in root, shoot and hypocotyl vascular elements, columella root caps, epidermal and cortex root cells and root-hypocotyl junctions. Observed predominantly in root imature xylem vessels (PubMed:18445131). Present in root developing xylems (PubMed:16103214, PubMed:17565617). Specifically expressed in vessels in the secondary xylem of the root-hypocotyl region, and in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8472060.0KC847206.1 Gossypium hirsutum NAC domain protein NAC29 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012466543.10.0PREDICTED: NAC domain-containing protein 7-like isoform X1
SwissprotQ9FWX21e-133NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A0D2LS840.0A0A0D2LS84_GOSRA; Uncharacterized protein
TrEMBLW6J8Q50.0W6J8Q5_GOSHI; NAC domain protein NAC29
STRINGGorai.001G048200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21112678
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-118NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]