PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G039500.1
Common NameB456_001G039500, LOC105776321
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CO-like
Protein Properties Length: 333aa    MW: 37146.8 Da    PI: 7.0974
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G039500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.81.6e-064890541
            zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                         C+ +e+ +++  C+ +   lC  C +++H+       H + p
  Gorai.001G039500.1 48 LCQVCEQAPAHVTCKGDAASLCVACDQHIHSAnplarqHVRLP 90
                        69****************************6567777776655 PP

2CCT67.43.8e-23271314144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea++lRYkeKrk+RkFeK+irY+sRK +Ae RpR+KGrF+k++
  Gorai.001G039500.1 271 REARVLRYKEKRKKRKFEKTIRYASRKSYAEMRPRIKGRFAKRT 314
                         9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.6E-5148IPR000315B-box-type zinc finger
PROSITE profilePS501199.897143IPR000315B-box-type zinc finger
CDDcd000212.96E-4548No hitNo description
PROSITE profilePS501199.8264491IPR000315B-box-type zinc finger
CDDcd000214.37E-64891No hitNo description
SMARTSM003364.3E-84991IPR000315B-box-type zinc finger
PROSITE profilePS5101716.39271313IPR010402CCT domain
PfamPF062035.4E-17271313IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MASKLCDSCK LATSDLFCCP HSAFLCCNCD STTHAANHLA SPHPRVCLCQ VCEQAPAHVT  60
CKGDAASLCV ACDQHIHSAN PLARQHVRLP IIPFYDSDNS VPAVKSNCAV NNFLDEPYFS  120
AVDGDTYVNQ EETEEAFWLL PNTNHKAVES PDVYTGQFLF SEIDLYLDLD YVPLNLKIGT  180
PEQTCSGTDA MVPTQSKSVE DPPVNHRCVN SDFTRSKPFT NYGYNPHSHS LSASSSLEVG  240
VVPDGSAMMR EISKQQGRRT ESMHELASAE REARVLRYKE KRKKRKFEKT IRYASRKSYA  300
EMRPRIKGRF AKRTDFEPDR TNIYGFGVVP SF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM2018110.0KM201811.1 Gossypium raimondii CONSTANS-like 4 protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454397.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T91e-106COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A0D2QKC00.0A0A0D2QKC0_G
STRINGBra009805.1-P1e-111(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27602765
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-97CONSTANS-like 4
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]
  2. Zhang R, et al.
    Molecular evolution and phylogenetic analysis of eight COL superfamily genes in group I related to photoperiodic regulation of flowering time in wild and domesticated cotton (Gossypium) species.
    PLoS ONE, 2015. 10(2): p. e0118669
    [PMID:25710777]