PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G032200.1
Common NameB456_001G032200, LOC105767953
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family WRKY
Protein Properties Length: 503aa    MW: 54840.9 Da    PI: 6.4641
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G032200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY80.71.5e-25193249259
                         --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         +DgynWrKYGqK+vk+ + +rsYY+Ct+++C+vkk +e+s++ ++v+ei+++g H he
  Gorai.001G032200.1 193 SDGYNWRKYGQKQVKSPKGSRSYYKCTFSNCQVKK-IECSDQTGHVIEIVNKGIHSHE 249
                         8********************************98.*********************8 PP

2WRKY96.61.7e-30365421359
                         -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         Dgy+WrKYGqK+vkg+ +pr+YYrCtsagCpv+k++e++ +++++v+itY+g H+h+
  Gorai.001G032200.1 365 DGYRWRKYGQKMVKGNSNPRNYYRCTSAGCPVRKHIETAVDNTNAVVITYKGVHDHD 421
                         9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.0E-20189251IPR003657WRKY domain
SuperFamilySSF1182901.7E-19190251IPR003657WRKY domain
SMARTSM007741.0E-23192250IPR003657WRKY domain
PROSITE profilePS5081116.49193251IPR003657WRKY domain
PfamPF031061.2E-16194248IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.5E-30348423IPR003657WRKY domain
PROSITE profilePS5081130.802358423IPR003657WRKY domain
SuperFamilySSF1182902.09E-26359423IPR003657WRKY domain
SMARTSM007743.9E-34363422IPR003657WRKY domain
PfamPF031061.4E-22365420IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MAETESQAKR HEGKQYDNSE GEEEEEEEEE EVDELEDEEE EEEEGVSRVN ESHGAGTAPS  60
SDAEVRASKL ETLTNDDRCE RLRENPTSEL KEGAESKEQV KIAHQKVLPS LAVQRAEAPK  120
QHLLQSSVSP TSSSQPSPTS ITQDISSPPT PTLPAQSHLD QKVNGASPPV ANQQNPSNLK  180
MLSFVPVVKT PVSDGYNWRK YGQKQVKSPK GSRSYYKCTF SNCQVKKIEC SDQTGHVIEI  240
VNKGIHSHEP PRKMNFTREN NILSSAVPLS IVREQPSRIP NDSDPSTSSK ESLPEPTVHT  300
ERKRQCSSGS DGHGDVQMKK EFLSEAEPNK RRKKGDAVCA GSVVKAGKKP KFVVHAAGDV  360
GISGDGYRWR KYGQKMVKGN SNPRNYYRCT SAGCPVRKHI ETAVDNTNAV VITYKGVHDH  420
DMPVPKKRHG PSSAPLVAAA APASMNNLQL AIADGEQKQV TSTKWSVGTE GELTGEAVDL  480
GGEKAMESAR TLLSIGFEIK PC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-24351423274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF6697600.0KF669760.1 Gossypium hirsutum WRKY transcription factor 10 (WRKY10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012443066.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595831e-137WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A0D2N2S20.0A0A0D2N2S2_G
STRINGGLYMA02G36510.11e-168(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-128WRKY DNA-binding protein 32
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]