PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G022100.1
Common NameB456_001G022100, LOC105802703
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 271aa    MW: 29893.4 Da    PI: 7.7641
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G022100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.49.9e-38151151101
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCa+Ck++rrkC+++C lap fpa+++k+f n++klFG++n++kl+++l+ ++r +a++++++eA++ra++Pv G++g+i +l++++ + k
  Gorai.001G022100.1  15 ACAVCKYQRRKCTNNCLLAPFFPANRHKDFLNTRKLFGVRNIIKLIENLNFQQRVIAIRTIIFEANMRAQNPVGGCYGLICDLNNKIGEYK 105
                         7****************************************************************************************** PP

              DUF260  92 aelallkeel 101
                         ++l+l++++l
  Gorai.001G022100.1 106 TQLNLVNQQL 115
                         ******9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.26414115IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-3415112IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MQSHTATNSA AGPQACAVCK YQRRKCTNNC LLAPFFPANR HKDFLNTRKL FGVRNIIKLI  60
ENLNFQQRVI AIRTIIFEAN MRAQNPVGGC YGLICDLNNK IGEYKTQLNL VNQQLAIYKS  120
QSVFTQYQQQ QPQKQYNDGG DQNLDAGFSI FDGGGGGSSP PLLSAYDVFE SNLVKAELEG  180
SNVLSDVDED MKPLFGNNKR DQSFSFDSEG HVVFSDDKKE QQTFCFDSGG SKIQNSGQHV  240
SKERGGLIQH QLKNDLNGGA SLFTLTSGKE *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6147750.0JX614775.1 Gossypium hirsutum clone NBRI_GE58409 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490001.10.0PREDICTED: LOB domain-containing protein 22-like isoform X1
TrEMBLA0A0D2LTN90.0A0A0D2LTN9_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2211645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-36LOB domain-containing protein 22
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]