PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G020300.1
Common NameB456_001G020300, LOC105801037
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 596aa    MW: 67078.8 Da    PI: 7.1827
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G020300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix90.81.4e-28411494185
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                         rW+  ev aLi++r ++e+++r+  lk+p We+vs+ m++ g++rs+k+Ckekwen+nk+++k ke+ kkr s++s+tc+yfdql
  Gorai.001G020300.1 411 RWPIAEVEALIQVRCDLESKFREPGLKGPVWEQVSSLMSSFGYQRSAKKCKEKWENINKYFRKSKENGKKR-SQQSKTCSYFDQL 494
                         8********************************************************************98.78889*******9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.411408468IPR017877Myb-like domain
PfamPF138372.3E-20410496No hitNo description
CDDcd122031.42E-24410475No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MHPIKYGAHH HHHHHHHHLQ QQQFMEDDDA SSSDSIFFIS NPHNHQQQPV FPYPLHSQQH  60
NKQHENPVTH QLFHHQFQPF QHPEPVHHHN QQQPFLAVNF KLGLNENSGK KEAALPLNPQ  120
QNGATFLHGN EQQQQHSLFL PRCLPPQEDS PIKEPFWKPL NRLDNRQCSA DGAKMVEGTK  180
YNKVLQQPGQ STSERSRNLD SKYGLFGELE AIYGLGKRGE AAQAGSGSAL TGENSPANVG  240
PSMNLTKFQE HDVVGANGGG GNVVATGVDH GSEASIGKEA SLRKVQKKKR KMKMKEQLSS  300
MVVAFESLVK QVTDHQECLH KRFLEFIERM DKERSVKEES WRQQEAEKRN REAVARAHEQ  360
ALASSREALI VSYLEKITGE SINLPGKTPL LQQPGNAMEP FNGVKVDNSS RWPIAEVEAL  420
IQVRCDLESK FREPGLKGPV WEQVSSLMSS FGYQRSAKKC KEKWENINKY FRKSKENGKK  480
RSQQSKTCSY FDQLGQLYSR IPITCPTSPT PLINSDIEVQ KQGDSDFLEA YIPERDLVTA  540
QVNISGNLKD SGMNIPKLDF DGIVGENVAQ GSKVKYNESH ESELDGDDND SDKGE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1281290LRKVQKKKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00651PBMTransfer from LOC_Os02g01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012487856.10.0PREDICTED: trihelix transcription factor GTL1-like
TrEMBLA0A0D2N4K80.0A0A0D2N4K8_GOSRA; Uncharacterized protein
STRINGGorai.001G020300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16469813
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.26e-48Trihelix family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]