PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G014200.2
Common NameB456_001G014200, LOC105794462
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 301aa    MW: 33770 Da    PI: 9.2228
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G014200.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.81.3e-31163219158
           CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         dep+YVN+KQy++Il+RR +Rakle ++kl  ksrkpylheSRh hA++R RgsgGrF
  Gorai.001G014200.2 163 DEPIYVNPKQYHGILRRRRHRAKLETRNKL-VKSRKPYLHESRHLHAMNRIRGSGGRF 219
                         79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.5E-35161222IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.805162222IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-27164219IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.5E-22165187IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.5E-22196219IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MASRVRILPK ENLLISCPPW WNSNEQQFVE IVPQNVSLKK AENHSQLYHN AKRFDLQLLD  60
HEPTLAEAGV TGVNNSQCNS SESGQVESCR KDIEGQTKPV YLLNNPNTLL SPSHPNYNRS  120
MACAQYPYTD AYFTGLFTPY GQQTIMTGTA PTRIPLPLDL AEDEPIYVNP KQYHGILRRR  180
RHRAKLETRN KLVKSRKPYL HESRHLHAMN RIRGSGGRFL SKKKPQRSDP TSIYISDIGC  240
LDQKDNNRSE LESRCSHTAE YGGSCTSCSH ISSITNNGGD ISRRAVSSCN GIQNCASLVR  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-20163233275NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012479556.10.0PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X2
TrEMBLA0A0D2PK970.0A0A0D2PK97_GOSRA; Uncharacterized protein
STRINGGorai.001G014200.10.0(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.13e-38nuclear factor Y, subunit A7
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]