PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G000600.1
Common NameB456_001G000600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 225aa    MW: 24556.1 Da    PI: 8.5194
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G000600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.67.6e-1560112355
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                          lkr rr+ +NRe+ArrsR+RK++ +  Le  +++L +eN++L  +l +  ++
  Gorai.001G000600.1  60 HLKRLRRMLSNRESARRSRKRKQEHLTDLEFLAEQLRGENDSLYRQLTNAHQQ 112
                         58*****************************************9777766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.2E-1157113No hitNo description
SMARTSM003383.6E-1158122IPR004827Basic-leucine zipper domain
PfamPF001702.4E-1260110IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.39260123IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.54E-1161112No hitNo description
CDDcd147021.22E-1663114No hitNo description
PROSITE patternPS0003606580IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
NLTPKRSTLD PQSSICGNNP KAKSRENEVR GATSASSPDH QSDNEETDVA QSEQSLDPSH  60
LKRLRRMLSN RESARRSRKR KQEHLTDLEF LAEQLRGEND SLYRQLTNAH QQFRDADTSN  120
RVLKSDVEAL RVKVKLAEDV LARGSLPCGL NQLVQTQLTS PQKIASHNHS LGRVANVSPT  180
ITIHGDVSSN SGLTISGDIS NVNANLNNGT GADAAVSCVS EIWR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17480RRSRKRK
27481RRSRKRKQ
37681SRKRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX9641833e-39JX964183.1 Gossypium hirsutum clone NBRI_TRANS-452 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490502.11e-163PREDICTED: basic leucine zipper 9-like
SwissprotQ9FUD31e-63BZIP9_ARATH; Basic leucine zipper 9
TrEMBLA0A0D2QG651e-164A0A0D2QG65_G
STRINGVIT_04s0008g02750.t013e-73(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63702641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.19e-65basic leucine zipper 9
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]