PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ56344.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family SBP
Protein Properties Length: 1324aa    MW: 133807 Da    PI: 6.6274
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ56344.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP77.12.8e-2466141176
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                 +C+v gC a l+ +k+y+ r +vCe h +a++++v+g+  rfCqqC+++  + ef  +k+sC   L++hn+r r k
  KXZ56344.1  66 VCEVLGCGASLEGLKRYYIRMRVCERHLNAQAIVVNGVVSRFCQQCAKWQFVGEFAGSKKSCIATLERHNARHRAK 141
                 6***********************************************************************9965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-2263127IPR004333Transcription factor, SBP-box
PROSITE profilePS5114121.06864141IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.76E-2365140IPR004333Transcription factor, SBP-box
PfamPF031101.3E-2467140IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1324 aa     Download sequence    Send to blast
MAGAPSGGMG APFDLGQDLL AAAVGAAAAG GGYLPLGGPD TDAGQEFGGL PVLETADRAD  60
PEPATVCEVL GCGASLEGLK RYYIRMRVCE RHLNAQAIVV NGVVSRFCQQ CAKWQFVGEF  120
AGSKKSCIAT LERHNARHRA KVLARQRDSP RADDAGGARG RGKGAKAGKA ADPTAAAATA  180
VRRRSAAAAA SSAVMDPCMQ GMAQLDGVAA HALASSDLSG GAAAVGGRGF DDVSGARVAA  240
AGAATAAELA FVQQQQPQGM AASAADVSAA PSKPASPNYY PYGGWDGANG TNGQLPAAGV  300
SIRPLVTTGG NGLVVAGERT GSGPLAAPSA RPGLPPQPPR PMAAPHWSEG WAGGRQLQAQ  360
GGPDFHPQLV GGSGMLQQQQ QPHQYHSHHH PHHQHPQQQQ QQWLGHARSA HQQLPPPPLD  420
VQRAMAAMPS LAAPHAQHHQ HQNQHHQQYQ QHMLRADPMY GDAGMYGAAV TTGVGGQTLL  480
HVRRDDSCSD GNTPVGSNAV GGGSGAGGAV SDSSGAHSQA TAKHAMMAAH APAREGSVGP  540
TLSGTSRSAA GPSASGAAGG TAMAANSPGT SSTEQDSAVR GSASASGSGY VGGDGGGAVS  600
GGAAGGGSQI GNVAARINSI MEELCPLIAQ FKQQVGPEAT RGSAGAAAGL AAAASSGSPA  660
LPPVVESAVA MMQQASQLAG SLAGQTSWGG AAAAHPQPGG AYSRPAAPPA GPGVWRPLQT  720
NPGIVVNVGA LAPSYSRPPA QGSAGPQQQP SQQLSQQPRQ QQQQQQATGF PAGQLAAGIE  780
GMAAAAVVAA PPPGYYAPAS SDSTAATAPY NSHNNGAAGP MYDGHQQQQY GGAGAGGARL  840
APAPPSGGLQ PMLGGSGVSG MVGEDADDEL LGQLLDFLDD PSDTELLFRQ QSMQNQQQLQ  900
YRGMAAAGQQ AVGAHQQAMQ ALHYGAPLRP LAWQPSLGAP VQPPTQQQQH PHQQQQHPQH  960
QQQQQQEQPN PFAAVAHGGL LVAQHSGGDS GGGSGLLAAD VSGGGVGGVP ELAGDDVDPR  1020
ELTRVSLKAM NVLPHELPPA LRANLRRWLK EARAEALQAT LRPGCLQLVV DVLRPASGPG  1080
CAPGEAASLL LMPHDPEQAA ADVFRILGQR LRDTYVQSLL PLAVLSGNGR GVDVLAAFAA  1140
EVLREPLRLD APQGPGGMSA LHLAALLPDG GALAAHLVAS QPWAAWAWLS LGWQPPVAAP  1200
EAPEAPAEAT DGTTAPKAEG LKAADDTNEE DKEGGEEDAE LPLPRPSTRL TPGSLSALLG  1260
QTEPLRRAAR LLQAGAALQR AGAERAGEMP DPATAALMGA VEAWGRTGAA LLSALCEQLG  1320
RTRL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150H2T80.0A0A150H2T8_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-16SBP family protein