PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ56258.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family bZIP
Protein Properties Length: 256aa    MW: 27303 Da    PI: 9.5881
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ56258.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.21.9e-094588346
                XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46
                + +++  +++NR+A++++RqRKk e+  L++ v+ L+a+  aLk
  KXZ56258.1 45 RQRNAEQMESNRVAQQKYRQRKKHEQSALQQAVDMLTAQVAALK 88
                56778899*******************************99998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.7E-63689No hitNo description
SMARTSM003388.0E-439108IPR004827Basic-leucine zipper domain
PfamPF001703.8E-84488IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.21E-54788No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MDADGDPDVR RREGTAAPGS TQGGGGGGGR SGKGNKASSG VKKRRQRNAE QMESNRVAQQ  60
KYRQRKKHEQ SALQQAVDML TAQVAALKAV EVRAVELEAS NAALQVTVSQ QGSSLMALQQ  120
HSAAQAAELD ATRAALSSSQ ATVAGQAKLI LDQQARLRLQ EQVIASLKDR LKEKIDEALQ  180
HVVPGTVCEK MVAAVKATLY GAKDVNGLQD TLAQLPEHLV HEICKNIFLV CKESWPELRV  240
RCSQQVGGGS CMTGAV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002951404.11e-109hypothetical protein VOLCADRAFT_91849
TrEMBLA0A150H3440.0A0A150H344_GONPE; Uncharacterized protein
STRINGEDP071081e-83(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1009533