PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ55451.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family SBP
Protein Properties Length: 934aa    MW: 98111.1 Da    PI: 7.0787
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ55451.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP112.32.8e-35180255277
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 Cqv+gC +dl+++keyh+r+++C+vh k ++vl +g+ qrfCqqC+rfh+l+ fD +++sCr++L+khn+rrr+++
  KXZ55451.1 180 CQVPGCGKDLTNLKEYHQRYRICDVHIKLQQVLKDGRLQRFCQQCGRFHDLTAFDGNRKSCREQLSKHNARRRRRA 255
                 ************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.6E-29177241IPR004333Transcription factor, SBP-box
PROSITE profilePS5114128.393177254IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.97E-31178254IPR004333Transcription factor, SBP-box
PfamPF031105.6E-30180253IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.201.7E-10678780IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484035.11E-11678776IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029714680788IPR020683Ankyrin repeat-containing domain
CDDcd002043.06E-8683772No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 934 aa     Download sequence    Send to blast
MENAWQGNLA GLFNEESAGG SERATSITSS DLDPFLLQGD DQTWAVEDWN WDPFNMFAAP  60
KEGSADHGAK PPCCSGNRGA SAPTCSGGRQ QADSSNKGNI PAAKDKPAVN MAGRGGDFVA  120
PGDISDFASD SEDEEVARRA PRGQAPSQQQ LQLQQLQLLH NQTNVVALHD AGDDNGLMEC  180
QVPGCGKDLT NLKEYHQRYR ICDVHIKLQQ VLKDGRLQRF CQQCGRFHDL TAFDGNRKSC  240
REQLSKHNAR RRRRAQVESA KGKANAAEAA AAGAAAAVAA AGSGASLDGD VGKLLASLMS  300
NPTHLHALRL LLGVPTHPAL PAAQAMAGST ADSSSDASGS DQARTYSLAR DILAGRNEFS  360
PAFESEHRMV RLSMKLFNKT PADLPADLRN QVTSWLASAP SAMEASIRPG CVFLTIQMLV  420
DEVGAAQAAA PGAAESLAEH LLTRTGSPFW HNGMCTLQLA SDIVLLRDGK VESGQGRGDG  480
RFPIVRRLGP LAVVAGQPAT LKMHGQNLDA PGCSVILRWG NKHLKAHLQA LSTHRAIVRL  540
PPLPDMNGPV WVEVTRGAYL SPAKQLLVAR DEALVDEISK LDVRNGPLSS ETVDVLIQDL  600
ALVLQHIAGE AGVTAQLPHA AIALKARRLL AMACDMGWAA VASAVLPLAC ARCSCAAEMV  660
AAIHAASVPS SGAGAGGDAR GLTLLHRAVR SGSIPLLAGV LAWGDSHGYR WRVDAAGPAG  720
ITPLHLSAMM DDARITLLLL DHSGWPAAFT HMRSDGGVTP FHLAFQMGHY QVDSLMAALG  780
GLHQVVDHAI NAAGAAAGAA AVAPNRRSRC GSSAALGFKL EEDEDVKPGL HGAAGRRSGV  840
GHKDCSEVDP CEVCHCTLPP LLLSIAASCS ECGRRRMCME SGASGCCRDC SCGGARPNLR  900
SDLGEVCNTT GHSTIFSITA LCQGCHGNRV LAVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-20175253684squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002948540.10.0hypothetical protein VOLCADRAFT_80184
TrEMBLA0A150H0340.0A0A150H034_GONPE; Uncharacterized protein
STRINGXP_002948540.10.0(Volvox carteri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP550058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.15e-24squamosa promoter binding protein-like 1