PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ55347.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family SBP
Protein Properties Length: 737aa    MW: 72203.8 Da    PI: 6.8988
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ55347.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP45.32.2e-141552377
                --HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP 23 vCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
                +C  h  +p+vl +g+ qrfCqqC +  +l++fD +krsCr  L+k  +r r++ 
  KXZ55347.1  1 MCAGHLLSPAVLKDGRLQRFCQQCCKLQDLDQFDGTKRSCRVALEKVRQRGRQRM 55
                5999999***************************************999988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114114.973154IPR004333Transcription factor, SBP-box
PfamPF031102.9E-14153IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-11255IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.106.4E-12241IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 737 aa     Download sequence    Send to blast
MCAGHLLSPA VLKDGRLQRF CQQCCKLQDL DQFDGTKRSC RVALEKVRQR GRQRMQQLRS  60
PEDRRGGGPA QGGQATHSAQ EALMSTDAAF DGGVGISLPD EELDAGGGGG GGAQLPAASG  120
VLRWLQAHAQ ARVQPAGHVQ QSGQQQAGLL GAAGEGLPGP WPPPPPPPVA LGTSGQAGAG  180
AGAGAGAEQL LDGGGGGASP AELALAQWPP LQLQLQRAAL GNGGGGGAVN AGGDMGAAEL  240
LGPALRRGAQ QLGPLPSAAA ATAAARSGQG LGGHDEAGRV AEALQAALAT AGGGGGGQLP  300
AAIRNSLVPL LASLPAVQLS LLASAYTPAS APPLVPLPPL QLSSAAAAAA REGCSLDLSQ  360
PPPSRPLPPP ASALEPTGRG GFGIGIGGDG SHSLLQAAAA TAAAGGGDNP DGDGPDGGRP  420
LRLIATQHGG GPPPLLLAPW GRAAGRLGEA DAPPGPGAPL LPALPTLTLG LAAPGAANAA  480
AAANGDRPAI THRPLRPSLV LDAPAASPMR PPRGAQAEPA ENGDPAAQRD RGPHARGQAS  540
AAALSQLQAL LVSLGSNAGG GGGGAAGGGG LLGAGAPLGG GGGGERSAHR ANGCANDRAN  600
GHANGHTNGH ANGHGSMHAN GHANGHANGS NKWDWPRSED GAEDGGQVLE QREESYGACE  660
EDEDEVQGEG EEVAGRDGHA WLGRGRGPAP RVGTRRRRSQ SSREREDADA SQALLALQSS  720
VPGGVGGTGG GRRRLRA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150GZK10.0A0A150GZK1_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101