PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ54995.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family SBP
Protein Properties Length: 291aa    MW: 29131.3 Da    PI: 9.307
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ54995.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP77.32.3e-242899475
                STT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
         SBP  4 vegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75
                ++gC  dls+ k+y +r+ vCe+h ka +v+v g+e rfCqqC +f ++++f+  +rsC  r ++ n rrr 
  KXZ54995.1 28 ADGCGRDLSSEKTYLQRYSVCEAHFKADAVVVGGQEVRFCQQCNKFQDVRDFEGMRRSCVARSKHRNMRRRL 99
                79*******************************************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114120.19623100IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.11E-2227100IPR004333Transcription factor, SBP-box
PfamPF031103.3E-262798IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.2E-232786IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MAANGSEKPG PQAFAMLDPY LGTALGRADG CGRDLSSEKT YLQRYSVCEA HFKADAVVVG  60
GQEVRFCQQC NKFQDVRDFE GMRRSCVARS KHRNMRRRLA STLNKGGSVD ELVLLGPGGD  120
GIQGHQSAKP KPKHQRQESY AGNGAVSGPR GGDTAEAAGV GGSSAAFPGV GGLGSTAAAA  180
AGGDGAVGSW LSLERVAQSF EQPGGRSGAG RVINLAALGG GSGGSSAAAA GGGLAGGASG  240
VAAGALENLW SDLGSFLTSA AGNAAEQRGT GPLMQPLSLR SHPHPSQAAA R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-142298783squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150GYX20.0A0A150GYX2_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.43e-18squamosa promoter binding protein-like 10