PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ54977.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family bZIP
Protein Properties Length: 1326aa    MW: 129348 Da    PI: 5.528
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ54977.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.61.5e-09713768358
                 XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                 ++k+  r+++NR+AAr++R++K + i + +   +++   N++L+ ++ +l+ ++a+
  KXZ54977.1 713 SDKALLRRERNRLAARKCRAKKMEFISHMQAQLDAMALRNEELRMQVATLQRMYAR 768
                 78999**********************************************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-4711775IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.967713764IPR004827Basic-leucine zipper domain
PfamPF077165.0E-7713764IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.03E-9713765No hitNo description
Gene3DG3DSA:1.20.5.1701.7E-10715764No hitNo description
CDDcd148091.54E-15718767No hitNo description
PROSITE patternPS000360719733IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1326 aa     Download sequence    Send to blast
MDLNHAPSMA FLSAMDERLD TMRLGSLDTL AAAAIAAEAA AAAADGGGGA GSMERADTAG  60
PIVALPPPAA LQPAPLPPPG VAGTVSAAGS AFAVGAAQRM LRAASSGLLL PPLTMGSGAA  120
ELLAPPLPPP GAIGAAGGTP RNDGGDRNAG GGGAAHGGGG AAAAAAGGNG GGSRGSGGAP  180
GLVGSGGSGG AATGWHHPHT HGPHSAPQQH RHYQHLPPQQ HQLYDWQQAQ YLRTTQTQQA  240
QQQSAGQLPM GQQPRGSQRG QAADGGREST ASPQRQRRQL QQQQADPWPG NPQPPRRHPD  300
HGRPPSAPGG GHPPHAASPP SGRVLDNSHP RPLGLEGSLR KQQPQQPQQH RQQQQQQQQQ  360
PAKRQGPRVV ATVGRPPQAS PPTRLGGGGG SVGGGRPPQR EAGAAGGLSQ RTDGAAGGRR  420
PRQAATRAVA NIAAVAREVY GFEGTGGRGG GGGGSGRAGL GYSVGGGLAG DGGGDEDGES  480
DEGKEGEGDD DSSDERSSGE EEEEEEEEGE EAGAGGARPL PPAMGSPGGS SAAGGAVSSA  540
AVTSPSNRDD GRFKHAVQAV QYGTGPDDDL PLPPKLPPLP RFRPTVQLLP SAASPRSGSA  600
GAGGGGGSGG GASSGAKRSA QGAAAAGQPQ SKKRKGVAAA PAPAVAPVKS TAVAPPPPLL  660
ARIPPLPTEA SLSEASLGAT ASMTAAEAVA AAAAAAEAAA AAVAGSPKAI KTSDKALLRR  720
ERNRLAARKC RAKKMEFISH MQAQLDAMAL RNEELRMQVA TLQRMYAREV QLKEVLKLVI  780
QSCWDLPGSG PRLPLTADEV LSELEAGNLD VNDLLEQLAP YLQGQGQAAA EGPAPPLQLP  840
APPRQQPFAP LPALPPPPGA IAEAQEHLPA PLRRSYDGRF AGPVADEGGY HAAAPGSRRG  900
GDGVQGDADA DGVAEGMEYE HGGGDGGGGG AASASAGMNV KQEREHPPGA APGPVQDEAA  960
SEECGGDGGE PGMAAETAAG AGGAVDGGGA AAVEAAAAAH TPGEDRALML PALGPSASPP  1020
LLDPGGGAAA AAAGGSAADA RPASDGGGGG REEGDSDDGS GNGGTGGTGD DGARAAAAPS  1080
LAVAGRMDSM DVLLAAMAAV ASMPNQDDNN FGGGAAPPHL LTALGAFPGG EGPPCEAGPS  1140
ASADAAATAA AMMAYFGGGS GIGGALVPPT AAAVAAATVP SVRSGADSGS DNSPTAASAA  1200
GGGYFVAVAG RDGGGTGLSP IGLSEATRPP PPPSLPSSLP PYLEPFSPPA PPHRSPHAAA  1260
AAATVAAHPS AFTPWSPGAP TAVGNPTGGG TGAGGGDEGD AMPPMPMFPY GLPVLLPSRV  1320
SGTCRR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1445453GGRGGGGGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150GYJ70.0A0A150GYJ7_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1129822