PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ54643.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family SBP
Protein Properties Length: 491aa    MW: 49165 Da    PI: 6.0407
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ54643.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP114.36.9e-36206282278
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 C+v+gC+adl+ + +y++r++ Ce+h kap+++ +g++qrfCqqC+rfhel efD +krsCr+rLa+hn rrrk+++
  KXZ54643.1 206 CHVDGCSADLTGLSSYYQRYRTCEAHLKAPSIMKDGIQQRFCQQCGRFHELAEFDGNKRSCRSRLASHNVRRRKRTE 282
                 **************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114128.273203280IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.105.2E-30205267IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.16E-31205284IPR004333Transcription factor, SBP-box
PfamPF031102.1E-32206279IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MQTGEGDGGA GDAAALANLA TILSGINAAL PPGPPQSGSG NSPGHVGQEG SPTEGRTSNG  60
GGTNQAGAGG GLSPGLILLP AGLNFPLQLN GPAGLQNLAP YLSLLPSLAP GTLGADGMPY  120
PGLPGMDLNG QLNLAALLAG GTLEGLDPAT LGAMDLTGLA DPGRKGPMSG SKRGNDGSGP  180
SYKRERSEEG RARESIPNLP HLKGKCHVDG CSADLTGLSS YYQRYRTCEA HLKAPSIMKD  240
GIQQRFCQQC GRFHELAEFD GNKRSCRSRL ASHNVRRRKR TEEAMASQAA AESHGVHASS  300
GAPGGMGGQG LGQLPLQQQH LLGGQQLTDL LQPGGLESLL SMATDPTKQG KTADEALAAF  360
LGSLPAGLLT GNLGDPTNQA IQLALQAVSS TAPDNLGQPL LDSLLKAGAA GGPTLTDLPN  420
ADLQSQLALA LAAAPAAAAA LGDGSGGGLD AATLAAAAAH LQDPRLGHHD PHGIKAEGTL  480
GGLPQDAPPQ L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-262062791184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150GY120.0A0A150GY12_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.12e-27squamosa promoter binding protein-like 3