PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ54511.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family bZIP
Protein Properties Length: 698aa    MW: 67435.2 Da    PI: 4.7529
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ54511.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.11.4e-1186137455
                 XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                  k+  r++kNR+AAr++R++K a +   +e+ keL a+N+++k ++ ++  +
  KXZ54511.1  86 EKARERREKNRIAARKCRAKKVAMVRGMQEELKELVAQNQEMKMQVVTWHRM 137
                 57888**************************************988877666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.4E-1280133No hitNo description
SMARTSM003380.001183151IPR004827Basic-leucine zipper domain
PfamPF077166.0E-1085131IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.87585131IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.5E-986136No hitNo description
CDDcd148091.60E-1688139No hitNo description
PROSITE patternPS00036091105IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    Send to blast
MGAAAAAAAQ QQDELDFGDT LAQPAAQPRA LPAGGSRSSG RSEGGRLQQR GCADGEDFDD  60
GEGEGEGDGE GEGGFPGEGE EDEDPEKARE RREKNRIAAR KCRAKKVAMV RGMQEELKEL  120
VAQNQEMKMQ VVTWHRMFSR EVKLREAMKR VILAVWSAHT VRATGFTAND VIIGLEAGTL  180
DVNGISALLQ HSGAPAAAAA AAAMGAAAAM ARDAAALSGA PPPPPLPAVP SGPPLLPPPG  240
GSGAFPVSPG GAAADGAQMP ALPVPPLSAC GSVGGLYSAA AAAYESLQPH PPGGLAAPPP  300
PARLTPRSPT AMATAGGGGG AFWAAAPPRA YDGVPVAPPP PSLHIKVPPR AVVDAAVGAF  360
ASAGPSSPVA GVVVPASPSG PVAVAVGSAA LQPLSPTACA TPHSPAAATA AAAAAAGQHG  420
FGSAGAATAE RLPARASFSA FSPYAAAMDA PPLCAAAAGE TACVGGGGGG GAERCCDLFG  480
GGVELKREAG DNGDAHPSAS SVITRGNGSI VTAATALPAP APSPAPTVRS AAADGTTSAA  540
AAGERSLPPL PSLEASFSLN RLLSLPGAAS HPAFRSSSLS QPLESLLAGS MGGGGGGGGF  600
GAGGGAGGAT SLGMSMRLPS FNLDTAPSST LLALADPSLL LARHDSGGME WLAALQGDVG  660
LGFGGGSGSG AGSGGGGSGA DEGLTGTEGG EEEGGEYA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150GXG10.0A0A150GXG1_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP890844