PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ54384.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family SBP
Protein Properties Length: 1095aa    MW: 113732 Da    PI: 7.0326
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ54384.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP112.82.1e-35353428277
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 Cqv+gC +dls++keyh+r+++C+vh k ++v+ +g+ qrfCqqC+rfh+l+ fD +++sCr++L+khn+rrr+++
  KXZ54384.1 353 CQVPGCGKDLSHLKEYHQRYRICDVHIKLQQVMKDGRLQRFCQQCGRFHDLTAFDGNRKSCREQLSKHNARRRRRT 428
                 *************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.7E-29349414IPR004333Transcription factor, SBP-box
PROSITE profilePS5114128.256350427IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.37E-31352427IPR004333Transcription factor, SBP-box
PfamPF031108.1E-30353426IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.206.2E-10809959IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484031.61E-9816961IPR020683Ankyrin repeat-containing domain
CDDcd002045.89E-9866959No hitNo description
PROSITE profilePS5029710.949868957IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1095 aa     Download sequence    Send to blast
MDFGLFQEDS SSERQNSLSS GGDLDPFLLQ GDDQTWAVED WNWDPFNMFA APKEVSGLSI  60
FEYVTRFGAA VAQVAADARH NGPPIFKSEP ELVANTGCHF PGMPAPMPAM PPIANVAASG  120
PQMSGMGFGM PMGMGMGMPW QNLPGMGAAA AVAAAAAAAS APALFANMAG ARSPFNALGW  180
GGMNLPGMAF ANAPNGGMMA LQRPATNFQA PSGLLNQQTS LALPPSSQPS PVMGSCGDSG  240
SLQGSADNAK PPCCSGNRAG DGPTCSGGRQ QADSSNKGNA PLHGSSHPAA YMGGRGGAGQ  300
AAAGDLSDVA ISESEDEREE VPRGRGGRGP QQVLHSLADV VALADAGDDS GLCQVPGCGK  360
DLSHLKEYHQ RYRICDVHIK LQQVMKDGRL QRFCQQCGRF HDLTAFDGNR KSCREQLSKH  420
NARRRRRTGV EPAKGKAAAG APTLEAPAAV PGSVAGVGAG PSAAGFDGDI GKLVSSLMSN  480
PTQLHALKLL LGVPTHPALP AMQPTAGMQL PLGGRAGSPD SPSDASASDQ ARTYGLARDI  540
LAGRNEFAPA YTSEHRTVRL SMKLFSRTPS DLPPDLRNQV TSWLASSPAA VEASIRPGCV  600
FLTVQLLLDE AAAAQAEAPG AVASLLEHLV FRSGCPFWRS GMLALQLGRE VVLMREGHVA  660
GVADDSAAPE LRRLGPLAAV AGRAVVLRLN GDRLDAPGSE VIMRWGAKHV KLPLQPVSPN  720
RALVHVPALP DICGPVWVEV GRGALLSEAQ QLLVVRDEAL AEEINKLDAR DSPLPTGRVE  780
ALLRDLALVL QHISGEQGAA LQLPHTAIAT KARRLLAVAC DMGWAAVASA VLPLACARCS  840
CAAEMVAAIH AAAGEPATAT GAEGADPRGL SLLHRAVRGG SVPLLAGMLA WGDSHGYRWP  900
VDAAGPAGIT PLHLCALLDD ADMALRLLDH CGWPAAFTEL RSDDGVTPFH LAFQMGRYQA  960
RARKARAAAA AKRRPGDGDD DDADEARPLA RGRQRGHHAE GCTPLHPCEA CHCTLPPLLL  1020
SIAASCSDCG RRRNCLPPLL SAGAASRCRE CACGGARPSL RADLGELCAS AAHSSVFSIT  1080
ALCQGCHGNR VLAVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A1e-19353427680squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1422427RRRRRT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002948544.10.0hypothetical protein VOLCADRAFT_58461
TrEMBLA0A150GX430.0A0A150GX43_GONPE; Uncharacterized protein
STRINGXP_002948544.10.0(Volvox carteri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP550058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.17e-23SBP family protein