PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ53060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family NF-YB
Protein Properties Length: 177aa    MW: 18994.3 Da    PI: 4.5297
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ53060.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB569.7e-18393292
       NF-YB  2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
                +e+d  lP + +++++k  +P + ++++d+ e+v  c +efi +v+se+++ + re r  i +d +l al++lGf  +v +++     ++e
  KXZ53060.1  3 EENDVSLPRTTLQKMIKDCMPPDMRVANDTVELVIACCTEFIQLVSSESNEVATREGRSIIHPDHVLKALTELGFPGFVGEVTSAWDTFKE 93
                588999*************************************************************************999887777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.0E-323138IPR009072Histone-fold
SuperFamilySSF471131.82E-285135IPR009072Histone-fold
PfamPF008087.0E-15872IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MSEENDVSLP RTTLQKMIKD CMPPDMRVAN DTVELVIACC TEFIQLVSSE SNEVATREGR  60
SIIHPDHVLK ALTELGFPGF VGEVTSAWDT FKEETKTAHS RKADLRKTGA EQAGLTEEEQ  120
ILLQQQMFAQ ARAQSMTTSE SAAAMHAAYE QALAAQAAAQ AAAAAGAGVG QAQQQPT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B6e-30413211133Transcription Regulator NC2 beta chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002953528.15e-84hypothetical protein VOLCADRAFT_94228
TrEMBLA0A150GUQ41e-128A0A150GUQ4_GONPE; Uncharacterized protein
STRINGEDP047679e-82(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP24221515
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.24e-31nuclear factor Y, subunit B13