PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ51490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family SBP
Protein Properties Length: 2162aa    MW: 221682 Da    PI: 6.7476
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ51490.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP86.53.2e-2774148175
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 
                 +C v++C++dls++k y+rr+++Ce h k+ + +++g+  rfCqqC+rfh l+ef+ +krsCrr L +   +rrk
  KXZ51490.1  74 TCMVKDCDVDLSSCKAYYRRFRICERHLKTLSLCIEGRASRFCQQCGRFHVLEEFEGNKRSCRRALLTRFYKRRK 148
                 5***************************************************************99887777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.4E-2870136IPR004333Transcription factor, SBP-box
PROSITE profilePS5114123.76972149IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-2574150IPR004333Transcription factor, SBP-box
PfamPF031102.6E-2475148IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 2162 aa     Download sequence    Send to blast
MDSQAWERGG VEADWLPGDY AWDARRLLVN HQGPDVDVLA LAAGANDGHE ADDRGGAIDT  60
DEPMQPAEEG GSETCMVKDC DVDLSSCKAY YRRFRICERH LKTLSLCIEG RASRFCQQCG  120
RFHVLEEFEG NKRSCRRALL TRFYKRRKLP VPPEALPPPP SDSAPRAAAK DTDPRPKAAR  180
ATASGDPNQP LQRRKRGRPR APPMDVRDLA AGDPEVGAEP TGNALLAQAG QQHQHQPQQG  240
LAQGRQRRGQ ALLASGLQLK QGGLGALGPD SPAPSGGGSS GTHSSGSAGG GDGAAAAAYH  300
RHSSAYPGAP LDIAGLMGPG GAGGAAGAGG AAAGVSNSYI TGLSLGLAEA AGLDLLRPLQ  360
TSVPAGEAAH SLSSARPPAG VGGALAGLAA QWQPQRLEAL QLGLGRQHEA RQLQGLQGQF  420
QPSPLQAVGV SRPHSQDPHH QQQHQQQLLH LERREQDASA LADIEGYLRG AAGGASGGVE  480
GLNRLQRHVM MLRQSSDAAA GPRAAYAASA ASREVAERPE TVFEQSWPAE TWSVNGWQLS  540
GANGGGSGGG ALNTGRAGAL GSGTRGAGGG GGGGGGSGFA AIVDPLELEL LSIASESLLN  600
DQSLRGPGKL SASMLMGLQS RRAQEGSHTQ QLQRMQAQPP YQQHPQQSLQ HQHQQSQQHN  660
QQQQLLQMQQ AQMQQQQQQQ PAFERSSQAS RQSQSQLSPR QLHAQLQELQ SDMRARGFGA  720
QPAGGAAGDG SGGVQLGRAP ADAMQLRPGS AGFPHLLCVK EEEGLSGLGR SASGMVPMET  780
RYAHLEYGPS AGLSASPAVG DAFQIVQMTA GIGGGFSSGG DASSGAATAV GSGSGGVGSG  840
AGGLNSPAVG GGGGASRVGV PTGNYMSARD AVLPQFASAG SAGSGSLQPL SLGQQSDRLQ  900
QQQRQELQHQ HHPQQQQQHA LQQPLRLGAG LGSGMGMGMG PAAEESAGAG GWAGGGYDCQ  960
DFQQQQLHQQ QQRQQRQQLQ QLLLERLQYQ QREQQRELQQ QQQGQHHQQQ QQHYMDGSDM  1020
APKSLAQQHH QQQYLSQHQY APRPELFANN PPAHAPQQHL HHHTQSQPEH ASLREAAQML  1080
LAQGGPRAEY APPATLMERL SLKIHNCRPE QLPRDLAERL ADLLASADAS VLQGFVRPGC  1140
THLLVDLLYG DRERLVSALL ALDADQRVAA ERIARGLLER RDGGEPWQRL HLQIGDMLLT  1200
LHDGDARLRQ RAALPAATAQ HGGRSRTGSL DSWCAPELVG IAPIAVVAAG KVQQRRQKGL  1260
WRRRAVVVVA AAAVAGGEGS NDREWGSNEV LSLRTTTPTS LAAAVTAVGG GAASAGRSGG  1320
GGGRLGREAG SGLFLSAADS EEDSDGDGGA WAVTAAGGAG DGMAAPAAVT TAMAQPPRQR  1380
GAAAVSERAL SAAAAPVAPQ HFPTAAGQQG GSASASGPAS GSAPGSARRR RLALWTPSGR  1440
PVDAVACFST ETYFSDISDG EDTDRPSQVS QSSEHLSFEG SDPDVVVLFV QPAPRPGLAI  1500
VEAESPAQRA ELTGGAGGGV PYSGAQAPAA SAGSRLSARA GGSSVVAGGV LSEWWPVVVV  1560
PESAAAAAGE LNGLLDEDCN EAWLRAMLVD FGLVLEALDP DSDPELELLL SASTGHAATT  1620
TAAAPGDPGP PPPGDRCLLT AAAASVAAAG SPSAAAQFGM GNPPLAALLA GRGSDDSVAP  1680
PSPMSTGALD ERCATAANNG LTASSSGGTG WEPRVALALA IQPLSLSDPC HKGGRMLSSA  1740
AALEAAPGDA EAILTGLPEL AAVALPPPPP RGAVGPRSSC DPIPLDTTPG APGGASQHLI  1800
DLSSGEAAHF FGFRGIGPDS DPVEPVALGS PRLASPLPRP PLASSPPPAT AARKVTTAAA  1860
GDAARAGDAA ATVAAAASAA ALAAGLLREA DAGNSAHYRA GHALPQTHSQ TAQWGPPEEA  1920
GRGDSAQERG RGPRLQHWWG SPSELAAVDA TTAPPPPPPA VRYIGEATAA AANAASAELR  1980
SAAPGPRPGR EHGAVAMWRL EQRRQLGPRA RSLLVFFLNR GLHQCAALAL ASLLRTAGAA  2040
PAIADAVAAA PTSLPASPLA TSGPAAAGDA TTAASAAAAP AAAPQPLLVL DPAALRSVAL  2100
AFATSAEAVR AESGMGLLHH AVRSGCPDAV RWLLRASRLA GAPFDVMEPG ERRFPVGSSR  2160
KW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A3e-1770151182squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131148KRSCRRALLTRFYKRRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150GQ700.0A0A150GQ70_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-18SBP family protein