PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ50420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family SBP
Protein Properties Length: 417aa    MW: 41782.9 Da    PI: 8.6038
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ50420.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP735.1e-2349124278
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 Cq+ +C  +ls+ak y rr+ vCe h ka+ v++ g + rfCqqC +f  l++f  ++rsC+ r ++ n rrrk+++
  KXZ50420.1  49 CQA-NCGRELSDAKLYLRRYSVCEPHFKAEWVTLGGGRFRFCQQCNKFQPLDNFAGNRRSCKARSEDRNLRRRKQRT 124
                 775.7*********************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-2243109IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.81146122IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.15E-2148125IPR004333Transcription factor, SBP-box
PfamPF031107.4E-2550121IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MAQLQAAQAH VQQAQADGEQ DQDNDPFGSP DGQSRKPRKL RKPNDVARCQ ANCGRELSDA  60
KLYLRRYSVC EPHFKAEWVT LGGGRFRFCQ QCNKFQPLDN FAGNRRSCKA RSEDRNLRRR  120
KQRTDERQAA EDDSDPGGRA GLLKVQGGQL AVPARVALAD NGMLRQLADP NDPLAQLQYA  180
QQVSQFLVAG AGGLAPAPAA AVQLPPGLDL AALMGGDFSA FGSPNANALS LLTAAAANGA  240
GLARTTAAPA PDPSGGAAVL QQLQLAQLLA KGAAAGGGGA AAAGGALGSL GAAAANGLAA  300
ALGAAGLNLS GVGSPTAAGA AGSGSLAHQL IMSTAAAGSS GSAGVAAPDS TLDLQSLVAQ  360
QLAQQLAAQQ AATQSPQQPG GGAVGGQGPM LLLGAGNQNM MLLSLEQLLT QGAGVAK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-13491211184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113119DRNLRRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150GM710.0A0A150GM71_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.15e-16squamosa promoter binding protein-like 8