PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ50272.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family SBP
Protein Properties Length: 1479aa    MW: 149999 Da    PI: 5.828
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ50272.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP81.31.4e-2545121177
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 +C v+gC + ++ +k+y+ r ++Ce+h  +++++v+g+  rfCqqC+rf  lsef  +k+sC  rL+k n+r r+k+
  KXZ50272.1  45 ICVVDGCGVSIAGLKRYFTRLRICEAHLGSSAIVVNGVVSRFCQQCGRFQPLSEFTGKKKSCIARLEKVNARHREKA 121
                 5***********************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-2341106IPR004333Transcription factor, SBP-box
PROSITE profilePS5114121.34143120IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-2345120IPR004333Transcription factor, SBP-box
PfamPF031102.7E-2646119IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1479 aa     Download sequence    Send to blast
MGTLGAEPSG IVVKTKPLLT NPKFADLPVY NSVMRFNNCS ASEAICVVDG CGVSIAGLKR  60
YFTRLRICEA HLGSSAIVVN GVVSRFCQQC GRFQPLSEFT GKKKSCIARL EKVNARHREK  120
AQLVKQQRRG ESPPAPQWMD SLPFTQAAVT GPIKLESILA APPAAAAAVV PQPIAPPEVQ  180
SNKLAPHLPL PLLGGQPSAD TAVSGPSRVS VERAVSLGGA SSSIVALPPT LVGAASLLPA  240
APGPAAAASS ESSLLEVKSL TAALVAKSDR ASSGESDFAS DVKEPDLPLT RIVTTAGPGL  300
VWYSIQRRPS EPDHASSGTR SPKTAATLAA GGSGGGSALL PMGSCASTAA GGNLTLPATA  360
ARSAALVAVR PPRIVYWNEV TTAINMVGDP AAAAAAAAAA AAVPSPPEDV RRALDAAAGE  420
LYYPLVLPVK LEVQVSDSAE PLGRVPAGKA GRALVPRIVT AGTSGESRPW TGSPSIAEPC  480
APAAVAMPVE NPSAAAARLT PAPALSNHSH HSAVGAAPGG GMPGSPLSAT NDRTTNDRTS  540
AAHEAAGGND VDASSRPSNA PGADTRVAVA ARISHIMTEL APLLAQAQSL AAEGPHDRDR  600
GVAPRRPPAV TEAVGEVDWQ QLRSTGGTLA APSLETAVAP TRGKRPLSQV VDDAAELMQR  660
AAQLDSVLHR RQRHQLPHQH QSQAEASLFE ARQLSAVQSR AAREPSPIQQ QQQQLQQADV  720
GLRQGPLQHS AVLAMPQAQA REQYRSSGAW PQAGPDVAAA LYAPEAQAAH GRPLENGSRG  780
GPVWQPQPRS QPQLQAVQAL AEEPMNDLMP DGGYGSVSVP PPASLAPSQQ QQLRDMQGLL  840
QHAHGLEDQV TARNRTVAAA LQQGISVHRQ ALAGMPYGNG GAGDAMDLDR VSIKAMALQP  900
EELPANLRSG MGRWLAGARA EALQGTLRPG CLQLVVDVVR PAAVAAAAGD LASLLIPASE  960
PEQAAADIFR FMGQRLRDTY VQVGDQVLAI RVGEDPVVYG WEEAAADGGL PGAKMPRLEG  1020
CSAAAVCAGA TARLRLRGQC LDQPGIRAFA RLRGRDLQAA AAVGPSSGAA GGASSGDQAL  1080
CVDVTLPARA AGLMVVEVAL GHLLGGWWPV LVLPRGQEGA ERELQDLQAQ EAGGAGALDR  1140
RLVYDLGQVL AVSGAAAAAA AAEAAAAAEI AAAAAALAIG GDVGGPTSPT PSVDSAGIGA  1200
VGDGGRSRSP GSPSSIGASG AGNGGGGSTN ATSAAGGWAY TDAGDTLAST SAAGSSHLST  1260
RFSAANASNG RGLDLQALLP LAVLSGSTAV VDELTAFADA ALGEPLRLDL PQGPAGMTLL  1320
HLAAVLDDGG AMASHLITTQ PWAAWTWLCV GWEPERAPGG TSEPSAAAED GASDGEAAAA  1380
SLAPKLDARV TPGSLSLALG CVEPLQRTMT MLVLREEDVV LVQGEAGLAG GKPAAEAAVG  1440
ALEASASVED GLADVVEAWG RLSGALLSAL CEELAKQRL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150GKE70.0A0A150GKE7_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.32e-17squamosa promoter binding protein-like 2