PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ48991.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family SBP
Protein Properties Length: 379aa    MW: 35168.2 Da    PI: 6.2487
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ48991.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP73.53.6e-235562576
                HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
         SBP 25 evhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76
                e h k ++v+ +gl qrfCqqC+rfh lsefD ++rsCr+ La+hn+rr kk
  KXZ48991.1  5 EYHLKVSSVIKDGLPQRFCQQCGRFHPLSEFDGSRRSCRTMLARHNQRRAKK 56
                689**********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114118.751156IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.19E-19556IPR004333Transcription factor, SBP-box
PfamPF031102.8E-20555IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.5E-16543IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MLNSEYHLKV SSVIKDGLPQ RFCQQCGRFH PLSEFDGSRR SCRTMLARHN QRRAKKVGQG  60
GSPGAEDMGP PPPAAAPPPP LPQAAASPPS DADVSLKMLQ QLGGSGLAAA MASFGGGPGG  120
GDGGGAGGAA GPTAVMQLQR LAGLGPLGQE GLSLADLMAA AAQLPGLGGG GGPGGGGGGA  180
GLLLPPPREP RVNDLLGELS RAAAAMAAAD SDLDGGRSGG GGGAMDFRRL TGEGRGGQGQ  240
SSPSSDADAA RAAALGRGGG GGGGGGGGGG ALRPTAEQSD ALAALASIVA AAASGGDGGG  300
GGPGGGGGDG GGGGYGRGGG GDGQRQRSHS GADGSGGGGD GGGSNDGGRA SGGSGSGGGR  360
DVDVDDGATH GSGRGEGLH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-144553384squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1214222GGRSGGGGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150GGN00.0A0A150GGN0_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.28e-16squamosa promoter binding protein-like 4